NECA3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NECA3_HUMAN
• UniProt AC: Q96P71
• Protein Name: N-terminal EF-hand calcium-binding protein 3
• Gene Name: NECAB3
• Organism: Homo sapiens (Human).
• Sequence Length: 396
• Subcellular Localization: Golgi apparatus .
• Protein Description: Inhibits the interaction of APBA2 with amyloid-beta precursor protein (APP), and hence allows formation of amyloid-beta. May enhance the activity of HIF1A and thus promote glycolysis under normoxic conditions; the function requires its ABM domain and may implicate the stabilization of the interaction between HIF1AN and APBA3..
• Protein Sequence: MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
136	Ubiquitination	LEYERASKVDQFVTR HHHHHHHHHHHHHHH	49.17	21906983
136 (in isoform 1)	Ubiquitination	-	49.17	21906983
136 (in isoform 2)	Ubiquitination	-	49.17	21906983
136 (in isoform 3)	Ubiquitination	-	49.17	21906983
170	Ubiquitination	ASDTLEAQAHGWRSD CHHHHHHHHHCCCCC	25.23	21963094
204	Phosphorylation	ALRSVSRSSTWSPGS HHHHCCCCCCCCCCC	25.31	28348404
205	Phosphorylation	LRSVSRSSTWSPGSS HHHCCCCCCCCCCCC	32.55	28348404
206	Phosphorylation	RSVSRSSTWSPGSSD HHCCCCCCCCCCCCC	31.07	22210691
217	Phosphorylation	GSSDTGRSSEAEMQW CCCCCCCCCHHHHHH	33.60	23403867
218	Phosphorylation	SSDTGRSSEAEMQWR CCCCCCCCHHHHHHH	39.19	22210691
313	Ubiquitination	EEGLQDFHRALRCYV HHHHHHHHHHHHHHC	23.53	21963094
331	Ubiquitination	GAQSHCLHVSAQKML CCCCEEEEEEHHHHH	19.51	21963094
331 (in isoform 2)	Ubiquitination	-	19.51	21906983
365	Ubiquitination	HQQSPGSKAFQRILI HCCCCCCHHHHHHHH	60.17	21963094
365 (in isoform 1)	Ubiquitination	-	60.17	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NECA3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NECA3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NECA3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.