NAT6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NAT6_HUMAN
• UniProt AC: Q93015
• Protein Name: N-acetyltransferase 6
• Gene Name: NAT6
• Organism: Homo sapiens (Human).
• Sequence Length: 286
• Subcellular Localization: Cytoplasm .
• Protein Description: Seems to be involved in N-acetylation. Acts on peptides with a N-terminal Met followed by Asp/Glu/Asn. May act as a tumor suppressor..
• Protein Sequence: MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
223	Malonylation	PSPRPPRKAPNLTAQ CCCCCCCCCCCCCCC	74.17	26320211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NAT6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NAT6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NAT6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.