UniProt ID | NANO3_HUMAN | |
---|---|---|
UniProt AC | P60323 | |
Protein Name | Nanos homolog 3 | |
Gene Name | NANOS3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 173 | |
Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, Stress granule . Cytoplasm, P-body . Co-localizes with PUM2, EIF2S1 and TIAL1 in the stress granules. Co-localizes with DCP1A in the P-body. | |
Protein Description | Plays a role in the maintenance of the undifferentiated state of germ cells regulating the spermatogonia cell cycle and inducing a prolonged transit in G1 phase. Affects cell proliferation probably by repressing translation of specific mRNAs. Maintains the germ cell lineage by suppressing both Bax-dependent and -independent apoptotic pathways. Essential in the early stage embryo to protect the migrating primordial germ cells (PGCs) from apoptosis.. | |
Protein Sequence | MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | LEPDQKRSLESSPAP CCHHHHHCCCCCCCH | 43.45 | - | |
146 | Methylation | KTQDTGHRRGGGGGA CCCCCCCCCCCCCCC | 40.04 | 24411165 | |
147 | Methylation | TQDTGHRRGGGGGAG CCCCCCCCCCCCCCC | 42.29 | 24411173 | |
156 | Methylation | GGGGAGFRGAGKSEP CCCCCCCCCCCCCCC | 32.89 | 24411181 | |
161 | Phosphorylation | GFRGAGKSEPSPSCS CCCCCCCCCCCCCCC | 54.55 | - | |
164 | Phosphorylation | GAGKSEPSPSCSPSM CCCCCCCCCCCCCCC | 25.95 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NANO3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NANO3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NANO3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNOT1_HUMAN | CNOT1 | physical | 24736845 | |
CNOT3_HUMAN | CNOT3 | physical | 24736845 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...