UniProt ID | MYL5_HUMAN | |
---|---|---|
UniProt AC | Q02045 | |
Protein Name | Myosin light chain 5 | |
Gene Name | MYL5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 173 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | ALRAQRASSNVFSNF CHHHHHHHCCCCCCC | 25.32 | 26657352 | |
30 | Phosphorylation | VFSNFEQTQIQEFKE CCCCCHHHHHHHHHH | 22.05 | 26657352 | |
40 | Phosphorylation | QEFKEAFTLMDQNRD HHHHHHHHHHHCCCC | 28.37 | 26437602 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYL5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYL5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYL5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...