MYF5_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MYF5_MOUSE
• UniProt AC: P24699
• Protein Name: Myogenic factor 5
• Gene Name: Myf5
• Organism: Mus musculus (Mouse).
• Sequence Length: 255
• Subcellular Localization: Nucleus.
• Protein Description: Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein..
• Protein Sequence: MDMTDGCQFSPSEYFYEGSCIPSPEDEFGDQFEPRVAAFGAHKAELQGSDDEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKNSSFDSIYCPDVSNACAADKSSVSSLDCLSSIVDRITSTEPSELALQDTASLSPATSANSQPATPGPSSSRLIYHVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	DGCQFSPSEYFYEGS CCCCCCCHHHCCCCC	43.67	-
49	Phosphorylation	HKAELQGSDDEEHVR CHHHHCCCCCHHCCC	29.00	24899341
80	Phosphorylation	KACKRKSTTMDRRKA HHHCCCCCHHHHHHH	29.22	28576409

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Fzr1	Q9R1K5	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MYF5_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MYF5_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CADH1_MOUSE	Cdh1	physical	17601983

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.