dbPTM

MUG35_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MUG35_SCHPO
UniProt AC	O94435
Protein Name	Meiotically up-regulated gene 35 protein
Gene Name	mug35
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	234
Subcellular Localization	Cytoplasm .
Protein Description	Has a role in meiosis..
Protein Sequence	MTNERHDELACLGIFPLKNPKQLDGVVTPILQLRVKFLAPTDRWWEGLVINKDLSKEESEELWKFLQSFDPRSAKFVGRGTPEDHVISYLFEAGKYEFEVFFYQKDHSLKLMGLYDKTQKQLLRRDSSGDLTSTDKERDVSPVSHSEKPYWDRYDLDQPSNQDVEESRNLVQEPKHRSKKYDRLGLDELVMEQTASLWKICSRNGMSVDEFLRFIRMGLESNFQHSNQVIPTHF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
127	Phosphorylation	KQLLRRDSSGDLTST HHHHHCCCCCCCCCC	34.12	28889911
128	Phosphorylation	QLLRRDSSGDLTSTD HHHHCCCCCCCCCCC	40.38	28889911
132	Phosphorylation	RDSSGDLTSTDKERD CCCCCCCCCCCCCCC	34.03	28889911
133	Phosphorylation	DSSGDLTSTDKERDV CCCCCCCCCCCCCCC	41.74	24763107
134	Phosphorylation	SSGDLTSTDKERDVS CCCCCCCCCCCCCCC	45.94	21712547
141	Phosphorylation	TDKERDVSPVSHSEK CCCCCCCCCCCCCCC	24.71	28889911
144	Phosphorylation	ERDVSPVSHSEKPYW CCCCCCCCCCCCCCC	25.36	25720772
146	Phosphorylation	DVSPVSHSEKPYWDR CCCCCCCCCCCCCCC	39.55	28889911
150	Phosphorylation	VSHSEKPYWDRYDLD CCCCCCCCCCCCCCC	30.89	29996109
154	Phosphorylation	EKPYWDRYDLDQPSN CCCCCCCCCCCCCCC	20.55	28889911
160	Phosphorylation	RYDLDQPSNQDVEES CCCCCCCCCCCHHHH	41.30	28889911
167	Phosphorylation	SNQDVEESRNLVQEP CCCCHHHHHHHHHCC	16.98	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MUG35_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MUG35_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MUG35_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MUG35_SCHPO	mug35	physical	26771498
CBH1_SCHPO	cbh1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MUG35_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-127; SER-128; THR-132AND SER-141, AND MASS SPECTROMETRY.	18257517 [Abstract]