UniProt ID | MUG35_SCHPO | |
---|---|---|
UniProt AC | O94435 | |
Protein Name | Meiotically up-regulated gene 35 protein | |
Gene Name | mug35 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 234 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Has a role in meiosis.. | |
Protein Sequence | MTNERHDELACLGIFPLKNPKQLDGVVTPILQLRVKFLAPTDRWWEGLVINKDLSKEESEELWKFLQSFDPRSAKFVGRGTPEDHVISYLFEAGKYEFEVFFYQKDHSLKLMGLYDKTQKQLLRRDSSGDLTSTDKERDVSPVSHSEKPYWDRYDLDQPSNQDVEESRNLVQEPKHRSKKYDRLGLDELVMEQTASLWKICSRNGMSVDEFLRFIRMGLESNFQHSNQVIPTHF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
127 | Phosphorylation | KQLLRRDSSGDLTST HHHHHCCCCCCCCCC | 34.12 | 28889911 | |
128 | Phosphorylation | QLLRRDSSGDLTSTD HHHHCCCCCCCCCCC | 40.38 | 28889911 | |
132 | Phosphorylation | RDSSGDLTSTDKERD CCCCCCCCCCCCCCC | 34.03 | 28889911 | |
133 | Phosphorylation | DSSGDLTSTDKERDV CCCCCCCCCCCCCCC | 41.74 | 24763107 | |
134 | Phosphorylation | SSGDLTSTDKERDVS CCCCCCCCCCCCCCC | 45.94 | 21712547 | |
141 | Phosphorylation | TDKERDVSPVSHSEK CCCCCCCCCCCCCCC | 24.71 | 28889911 | |
144 | Phosphorylation | ERDVSPVSHSEKPYW CCCCCCCCCCCCCCC | 25.36 | 25720772 | |
146 | Phosphorylation | DVSPVSHSEKPYWDR CCCCCCCCCCCCCCC | 39.55 | 28889911 | |
150 | Phosphorylation | VSHSEKPYWDRYDLD CCCCCCCCCCCCCCC | 30.89 | 29996109 | |
154 | Phosphorylation | EKPYWDRYDLDQPSN CCCCCCCCCCCCCCC | 20.55 | 28889911 | |
160 | Phosphorylation | RYDLDQPSNQDVEES CCCCCCCCCCCHHHH | 41.30 | 28889911 | |
167 | Phosphorylation | SNQDVEESRNLVQEP CCCCHHHHHHHHHCC | 16.98 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MUG35_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MUG35_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MUG35_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MUG35_SCHPO | mug35 | physical | 26771498 | |
CBH1_SCHPO | cbh1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...