UniProt ID | MUB1_ARATH | |
---|---|---|
UniProt AC | Q9MAB9 | |
Protein Name | Membrane-anchored ubiquitin-fold protein 1 | |
Gene Name | MUB1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 117 | |
Subcellular Localization |
Cell membrane Lipid-anchor . |
|
Protein Description | May serve as docking site to facilitate the association of other proteins to the plasma membrane.. | |
Protein Sequence | MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLISAGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKKPKGDPKMNKCVCSVM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
112 | S-palmitoylation | GDPKMNKCVCSVM-- CCCCCCCCCEECC-- | 2.95 | - | |
114 | Methylation | PKMNKCVCSVM---- CCCCCCCEECC---- | 3.39 | 16831869 | |
114 | Farnesylation | PKMNKCVCSVM---- CCCCCCCEECC---- | 3.39 | 16831869 | |
114 | Farnesylation | PKMNKCVCSVM---- CCCCCCCEECC---- | 3.39 | 16831869 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MUB1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MUB1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MUB1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBC8_ARATH | UBC8 | physical | 21345795 | |
UBC9_ARATH | UBC9 | physical | 21345795 | |
UBC10_ARATH | UBC10 | physical | 21345795 | |
NAC89_ARATH | NAC089 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Prenylation | |
Reference | PubMed |
"MUBS: a family of ubiquitin-fold proteins that are plasma membrane-anchored by prenylation."; Downes B.P., Saracco S.A., Lee S.S., Crowell D.N., Vierstra R.D.; J. Biol. Chem. 281:27145-27157(2006). Cited for: IDENTIFICATION, NOMENCLATURE, ISOPRENYLATION AT CYS-114, MUTAGENESISOF CYS-114, AND SUBCELLULAR LOCATION. |