UniProt ID | MTURN_HUMAN | |
---|---|---|
UniProt AC | Q8N3F0 | |
Protein Name | Maturin | |
Gene Name | MTURN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 131 | |
Subcellular Localization | ||
Protein Description | May be involved in early neuronal development.. | |
Protein Sequence | MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | TERRMDFYADPGVSF HHHHHHHHCCCCCEE | 24681962 | ||
47 (in isoform 3) | Ubiquitination | - | 21890473 | ||
55 (in isoform 3) | Ubiquitination | - | 21890473 | ||
58 | Phosphorylation | GDNFHVWSESEDCLP CCCEEEEECCCCHHH | - | ||
79 | Ubiquitination | DYISSCGKKTLHEVL HHHHHCCHHHHHHHH | 23000965 | ||
80 | Ubiquitination | YISSCGKKTLHEVLE HHHHCCHHHHHHHHH | 23000965 | ||
80 (in isoform 1) | Ubiquitination | - | 21890473 | ||
80 (in isoform 2) | Ubiquitination | - | 21890473 | ||
88 | Acetylation | TLHEVLEKVFKSFRP HHHHHHHHHHHHHHH | 25953088 | ||
88 | Ubiquitination | TLHEVLEKVFKSFRP HHHHHHHHHHHHHHH | 23000965 | ||
88 (in isoform 1) | Ubiquitination | - | 21890473 | ||
88 (in isoform 2) | Ubiquitination | - | 21890473 | ||
91 | Ubiquitination | EVLEKVFKSFRPLLG HHHHHHHHHHHHHHC | 23000965 | ||
110 | Phosphorylation | DDDAFEEYSADVEEE CCHHHHHHCCCCCCC | 27642862 | ||
129 | Phosphorylation | DHPQMGVSQQ----- CCCCCCCCCC----- | 28348404 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTURN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTURN_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...