| UniProt ID | MTURN_HUMAN | |
|---|---|---|
| UniProt AC | Q8N3F0 | |
| Protein Name | Maturin | |
| Gene Name | MTURN | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 131 | |
| Subcellular Localization | ||
| Protein Description | May be involved in early neuronal development.. | |
| Protein Sequence | MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Phosphorylation | TERRMDFYADPGVSF HHHHHHHHCCCCCEE | 24681962 | ||
| 47 (in isoform 3) | Ubiquitination | - | 21890473 | ||
| 55 (in isoform 3) | Ubiquitination | - | 21890473 | ||
| 58 | Phosphorylation | GDNFHVWSESEDCLP CCCEEEEECCCCHHH | - | ||
| 79 | Ubiquitination | DYISSCGKKTLHEVL HHHHHCCHHHHHHHH | 23000965 | ||
| 80 | Ubiquitination | YISSCGKKTLHEVLE HHHHCCHHHHHHHHH | 23000965 | ||
| 80 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 80 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 88 | Acetylation | TLHEVLEKVFKSFRP HHHHHHHHHHHHHHH | 25953088 | ||
| 88 | Ubiquitination | TLHEVLEKVFKSFRP HHHHHHHHHHHHHHH | 23000965 | ||
| 88 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 88 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 91 | Ubiquitination | EVLEKVFKSFRPLLG HHHHHHHHHHHHHHC | 23000965 | ||
| 110 | Phosphorylation | DDDAFEEYSADVEEE CCHHHHHHCCCCCCC | 27642862 | ||
| 129 | Phosphorylation | DHPQMGVSQQ----- CCCCCCCCCC----- | 28348404 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTURN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTURN_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...