dbPTM

MSX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MSX2_MOUSE
UniProt AC	Q03358
Protein Name	Homeobox protein MSX-2
Gene Name	Msx2
Organism	Mus musculus (Mouse).
Sequence Length	267
Subcellular Localization	Nucleus.
Protein Description	Acts as a transcriptional regulator in bone development. Represses the ALPL promoter activity and antogonizes the stimulatory effect of DLX5 on ALPL expression during osteoblast differentiation. Probable morphogenetic role. May play a role in limb-pattern formation. In osteoblasts, suppresses transcription driven by the osteocalcin FGF response element (OCFRE). Binds to the homeodomain-response element of the ALPL promoter..
Protein Sequence	MASPTKGGDLFSSDEEGPAVLAGPGPGPGGAEGSAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	TKGGDLFSSDEEGPA CCCCCCCCCCCCCCC	44.15	26643407
13	Phosphorylation	KGGDLFSSDEEGPAV CCCCCCCCCCCCCCE	41.53	26643407
91	Phosphorylation	HGVRDAHSPGPLVKP CCCCCCCCCCCCCCC	33.02	26824392
122	Phosphorylation	WIQEPGRYSPPPRHM CCCCCCCCCCCCCCC	31.29	26643407
123	Phosphorylation	IQEPGRYSPPPRHMS CCCCCCCCCCCCCCC	29.57	25159016
130	Phosphorylation	SPPPRHMSPTTCTLR CCCCCCCCCCCCCCC	16.99	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MSX2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MSX2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MSX2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MINT_MOUSE	Spen	physical	20211142
RUNX2_MOUSE	Runx2	physical	15060165
HDAC1_MOUSE	Hdac1	physical	15060165

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MSX2_MOUSE

Related Literatures of Post-Translational Modification