UniProt ID | MSRB2_HUMAN | |
---|---|---|
UniProt AC | Q9Y3D2 | |
Protein Name | Methionine-R-sulfoxide reductase B2, mitochondrial | |
Gene Name | MSRB2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 182 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.. | |
Protein Sequence | MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | PGLGEAGSLATCELP CCCCCCCCEEECCCC | 23.14 | 24275569 | |
64 | Phosphorylation | KLTPEQFYVTREKGT CCCHHHEEEECCCCC | 10.70 | 27642862 | |
71 | Phosphorylation | YVTREKGTEPPFSGI EEECCCCCCCCCCCE | 57.28 | 30206219 | |
79 | Phosphorylation | EPPFSGIYLNNKEAG CCCCCCEEECCCCCC | 13.60 | 30206219 | |
83 | Acetylation | SGIYLNNKEAGMYHC CCEEECCCCCCEEEE | 48.11 | 11922981 | |
88 | Phosphorylation | NNKEAGMYHCVCCDS CCCCCCEEEEEECCC | 7.37 | - | |
95 | Phosphorylation | YHCVCCDSPLFSSEK EEEEECCCCCCCCCC | 15.02 | - | |
100 | Phosphorylation | CDSPLFSSEKKYCSG CCCCCCCCCCCCCCC | 46.21 | - | |
120 | Phosphorylation | FSEAHGTSGSDESHT HHHHHCCCCCCHHHH | 40.67 | 24275569 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSRB2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSRB2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSRB2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NEDD8_HUMAN | NEDD8 | physical | 22939629 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...