UniProt ID | MSMO1_HUMAN | |
---|---|---|
UniProt AC | Q15800 | |
Protein Name | Methylsterol monooxygenase 1 | |
Gene Name | MSMO1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 293 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes the first step in the removal of the two C-4 methyl groups of 4,4-dimethylzymosterol.. | |
Protein Sequence | MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Ubiquitination | PENPLQEPFKNAWNY CCCCCCCCCHHHHHH | 32.33 | 22817900 | |
36 | Ubiquitination | LQEPFKNAWNYMLNN CCCCCHHHHHHHHHC | 9.11 | 21890473 | |
36 | Ubiquitination | LQEPFKNAWNYMLNN CCCCCHHHHHHHHHC | 9.11 | 21890473 | |
40 | Ubiquitination | FKNAWNYMLNNYTKF CHHHHHHHHHCCCCC | 2.67 | 22817900 | |
80 | Ubiquitination | QFIPYMKKYKIQKDK HHHHHHHHHCCCCCC | 34.93 | 22817900 | |
82 | Ubiquitination | IPYMKKYKIQKDKPE HHHHHHHCCCCCCCC | 47.76 | 22817900 | |
85 | Ubiquitination | MKKYKIQKDKPETWE HHHHCCCCCCCCCHH | 71.80 | 21906983 | |
87 | Ubiquitination | KYKIQKDKPETWENQ HHCCCCCCCCCHHHH | 52.36 | 21906983 | |
96 | Ubiquitination | ETWENQWKCFKVLLF CCHHHHHHHHHHHHH | 21.74 | 29967540 | |
153 | Ubiquitination | AVIEDTWHYFLHRLL HHHHHHHHHHHHHHH | 12.93 | 21890473 | |
153 | Ubiquitination | AVIEDTWHYFLHRLL HHHHHHHHHHHHHHH | 12.93 | 23000965 | |
155 | Ubiquitination | IEDTWHYFLHRLLHH HHHHHHHHHHHHHHH | 2.75 | 23000965 | |
156 | Ubiquitination | EDTWHYFLHRLLHHK HHHHHHHHHHHHHHH | 1.49 | 23000965 | |
159 | Ubiquitination | WHYFLHRLLHHKRIY HHHHHHHHHHHHHHH | 3.57 | 23000965 | |
160 | Ubiquitination | HYFLHRLLHHKRIYK HHHHHHHHHHHHHHH | 3.92 | 24816145 | |
163 | Ubiquitination | LHRLLHHKRIYKYIH HHHHHHHHHHHHHHH | 29.73 | 22817900 | |
167 | Ubiquitination | LHHKRIYKYIHKVHH HHHHHHHHHHHHHHH | 35.04 | 22817900 | |
171 | Ubiquitination | RIYKYIHKVHHEFQA HHHHHHHHHHHHHCC | 33.43 | 22817900 | |
274 | Phosphorylation | WWDRIFGTDSQYNAY HHHHHHCCHHHHHHH | 23.02 | 28796482 | |
276 | Phosphorylation | DRIFGTDSQYNAYNE HHHHCCHHHHHHHHH | 34.11 | 28796482 | |
278 | Phosphorylation | IFGTDSQYNAYNEKR HHCCHHHHHHHHHHH | 13.00 | 28796482 | |
281 | Phosphorylation | TDSQYNAYNEKRKKF CHHHHHHHHHHHHHH | 21.88 | 28796482 | |
284 | Ubiquitination | QYNAYNEKRKKFEKK HHHHHHHHHHHHHHH | 66.92 | 23000965 | |
286 | Ubiquitination | NAYNEKRKKFEKKTE HHHHHHHHHHHHHCC | 73.25 | 23000965 | |
287 | Ubiquitination | AYNEKRKKFEKKTE- HHHHHHHHHHHHCC- | 63.89 | 23000965 | |
290 | Ubiquitination | EKRKKFEKKTE---- HHHHHHHHHCC---- | 69.03 | 23000965 | |
291 | Ubiquitination | KRKKFEKKTE----- HHHHHHHHCC----- | 51.17 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSMO1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSMO1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSMO1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ODPAT_HUMAN | PDHA2 | physical | 22939629 | |
MIC60_HUMAN | IMMT | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...