dbPTM

MS4A3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MS4A3_HUMAN
UniProt AC	Q96HJ5
Protein Name	Membrane-spanning 4-domains subfamily A member 3
Gene Name	MS4A3
Organism	Homo sapiens (Human).
Sequence Length	214
Subcellular Localization	Endomembrane system Multi-pass membrane protein. Cytoplasm, perinuclear region. Located in the perinuclear area.
Protein Description	Hematopoietic modulator for the G1-S cell cycle transition. Modulates the level of phosphorylation of cyclin-dependent kinase 2 (CDK2) through its direct binding to cyclin-dependent kinase inhibitor 3 (CDKN3/KAP)..
Protein Sequence	MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	GSASAHGTPGSEAGP CCCCCCCCCCCCCCH	18.01	24275569
71	Phosphorylation	ALGVFLGSLQYPYHF HHHHHHHHCCCCHHH	17.91	22210691
76	Phosphorylation	LGSLQYPYHFQKHFF HHHCCCCHHHHHHEE	15.44	22210691
149	Phosphorylation	NIAVNIQSLRSCHSS HEEHHHHHHHHCCCC	23.19	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MS4A3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MS4A3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MS4A3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CDKN3_HUMAN	CDKN3	physical	11781350

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MS4A3_HUMAN

Related Literatures of Post-Translational Modification