| UniProt ID | MPZL3_HUMAN | |
|---|---|---|
| UniProt AC | Q6UWV2 | |
| Protein Name | Myelin protein zero-like protein 3 | |
| Gene Name | MPZL3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 235 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | Mediates homophilic cell-cell adhesion.. | |
| Protein Sequence | MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | QGVYIVFSLEIRADA CCEEEEEEEEEECCE | 17.75 | 24719451 | |
| 123 | N-linked_Glycosylation | SNPTIKDNGTFSCAV CCCEECCCCEEEEEE | 46.53 | UniProtKB CARBOHYD | |
| 204 | Phosphorylation | KKSSIEVSDDTDQEE CCCEEEECCCCCHHH | 19.58 | 25849741 | |
| 207 | Phosphorylation | SIEVSDDTDQEEEEA EEEECCCCCHHHHHH | 44.57 | 25849741 | |
| 229 | Phosphorylation | RCAECLDSDYEETY- HHHHHHCCCCCCCC- | 29.19 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPZL3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPZL3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPZL3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MPZL2_HUMAN | MPZL2 | physical | 21982860 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...