UniProt ID | MPZL2_HUMAN | |
---|---|---|
UniProt AC | O60487 | |
Protein Name | Myelin protein zero-like protein 2 | |
Gene Name | MPZL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 215 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | Mediates homophilic cell-cell adhesion.. | |
Protein Sequence | MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MYGKSSTRA ------CCCCHHHHH | 33.01 | 25072903 | |
5 | Phosphorylation | ---MYGKSSTRAVLL ---CCCCHHHHHHHH | 32.36 | 25072903 | |
6 | Phosphorylation | --MYGKSSTRAVLLL --CCCCHHHHHHHHH | 25.96 | 25072903 | |
7 | Phosphorylation | -MYGKSSTRAVLLLL -CCCCHHHHHHHHHH | 29.73 | 25072903 | |
39 | N-linked_Glycosylation | SRVLEAVNGTDARLK HHHHHHHCCCCCEEE | 55.48 | 19159218 | |
96 | Phosphorylation | GRFKDRVSWDGNPER CCCCCCCCCCCCHHH | 21.97 | 30257219 | |
118 | N-linked_Glycosylation | WKLQFDDNGTYTCQV EEEEECCCCEEEEEE | 46.69 | UniProtKB CARBOHYD | |
194 | Ubiquitination | AHKVVEIKSKEEERL HHHEEEECCHHHHHH | 41.80 | - | |
195 | Phosphorylation | HKVVEIKSKEEERLN HHEEEECCHHHHHHH | 51.46 | 23312004 | |
206 | Ubiquitination | ERLNQEKKVSVYLED HHHHHCCCEEEEEEC | 38.70 | - | |
208 | Phosphorylation | LNQEKKVSVYLEDTD HHHCCCEEEEEECCC | 17.58 | 25159151 | |
210 | Phosphorylation | QEKKVSVYLEDTD-- HCCCEEEEEECCC-- | 9.25 | 28152594 | |
214 | Phosphorylation | VSVYLEDTD------ EEEEEECCC------ | 33.94 | 28355574 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPZL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPZL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPZL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AP1M1_HUMAN | AP1M1 | physical | 26186194 | |
OCLN_HUMAN | OCLN | physical | 26186194 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-39, AND MASS SPECTROMETRY. |