MPPA1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPPA1_ARATH
• UniProt AC: Q9ZU25
• Protein Name: Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial
• Gene Name: At1g51980 {ECO:0000312|Araport:AT1G51980}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 503
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: Cleaves presequences (transit peptides) from mitochondrial protein precursors..
• Protein Sequence: MYRTAASRARALKGVLTRSLRPARYASSSAVAETSSSTPAYLSWLSGGSRAALTSLDMPLQGVSLPPPLADKVEPSKLQITTLPNGLKIASETTPNPAASIGLYVDCGSIYEAPYFHGATHLLERMAFKSTLNRTHFRLVREIEAIGGNTSASASREQMSYTIDALKTYVPEMVEVLIDSVRNPAFLDWEVNEELRKMKVEIAELAKNPMGFLLEAIHSAGYSGPLASPLYAPESALDRLNGELLEEFMTENFTAARMVLAASGVEHEELLKVAEPLTSDLPNVPPQLAPKSQYVGGDFRQHTGGEATHFAVAFEVPGWNNEKEAVTATVLQMLMGGGGSFSAGGPGKGMHSWLYRRVLNEYQEVQSCTAFTSIFNDTGLFGIYGCSSPQFAAKAIELAAKELKDVAGGKVNQAHLDRAKAATKSAVLMNLESRMIAAEDIGRQILTYGERKPVDQFLKSVDQLTLKDIADFTSKVISKPLTMGSFGDVLAVPSYDTISSKFR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
150	Phosphorylation	IEAIGGNTSASASRE HHHCCCCCCCCCCHH	29.01	29654922
155	Phosphorylation	GNTSASASREQMSYT CCCCCCCCHHHHCHH	33.58	29654922
401	Acetylation	KAIELAAKELKDVAG HHHHHHHHHHHHHHC	58.95	24727099
404	Acetylation	ELAAKELKDVAGGKV HHHHHHHHHHHCCCC	51.77	24727099
467	Acetylation	SVDQLTLKDIADFTS HHHCCCHHHHHHHHH	41.68	24727099
475	Acetylation	DIADFTSKVISKPLT HHHHHHHHHHCCCCC	40.30	24727099

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPPA1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MPPA1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPPA1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BBX32_ARATH	BBX32	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.