MPK10_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPK10_ARATH
• UniProt AC: Q9M1Z5
• Protein Name: Mitogen-activated protein kinase 10
• Gene Name: MPK10
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 393
• Protein Sequence: MEPTNDAETLETQGEVTTAIWPSSQILKTTIDIPGTLSHDGRYIQYNLFGHIFELPAKYKPPIRPIGRGACGIVCSAVDSETNEKVAIKKITQVFDNTIEAKRTLREIKLLRHFDHENIVAIRDVILPPQRDSFEDVYIVNELMEFDLYRTLKSDQELTKDHGMYFMYQILRGLKYIHSANVLHRDLKPSNLLLSTQCDLKICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTAAIDVWSVGCIFMEIMNREPLFPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRYIRQLPTLPRQSFTEKFPNVPPLAIDLVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEPFNFDLDEHPFSEEQFRELIYCEALAFNPETSND

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
211	Phosphorylation	DFGLARATPESNLMT CCCCCCCCCCCCHHC	23.26	25368622
214	Phosphorylation	LARATPESNLMTEYV CCCCCCCCCHHCHHH	36.15	25368622
218	Phosphorylation	TPESNLMTEYVVTRW CCCCCHHCHHHHHHE	27.59	25368622
220	Phosphorylation	ESNLMTEYVVTRWYR CCCHHCHHHHHHEEC	7.34	25368622
223	Phosphorylation	LMTEYVVTRWYRAPE HHCHHHHHHEECCHH	12.87	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPK10_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
218	T	Phosphorylation	Dually phosphorylated on Thr-218 and Tyr-220, which activates the enzyme.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPK10_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPK10_ARATH	MPK10	physical	25064848

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.