UniProt ID | MPK10_ARATH | |
---|---|---|
UniProt AC | Q9M1Z5 | |
Protein Name | Mitogen-activated protein kinase 10 | |
Gene Name | MPK10 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 393 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEPTNDAETLETQGEVTTAIWPSSQILKTTIDIPGTLSHDGRYIQYNLFGHIFELPAKYKPPIRPIGRGACGIVCSAVDSETNEKVAIKKITQVFDNTIEAKRTLREIKLLRHFDHENIVAIRDVILPPQRDSFEDVYIVNELMEFDLYRTLKSDQELTKDHGMYFMYQILRGLKYIHSANVLHRDLKPSNLLLSTQCDLKICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTAAIDVWSVGCIFMEIMNREPLFPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRYIRQLPTLPRQSFTEKFPNVPPLAIDLVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEPFNFDLDEHPFSEEQFRELIYCEALAFNPETSND | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
211 | Phosphorylation | DFGLARATPESNLMT CCCCCCCCCCCCHHC | 23.26 | 25368622 | |
214 | Phosphorylation | LARATPESNLMTEYV CCCCCCCCCHHCHHH | 36.15 | 25368622 | |
218 | Phosphorylation | TPESNLMTEYVVTRW CCCCCHHCHHHHHHE | 27.59 | 25368622 | |
220 | Phosphorylation | ESNLMTEYVVTRWYR CCCHHCHHHHHHEEC | 7.34 | 25368622 | |
223 | Phosphorylation | LMTEYVVTRWYRAPE HHCHHHHHHEECCHH | 12.87 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPK10_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
218 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPK10_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPK10_ARATH | MPK10 | physical | 25064848 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...