dbPTM

ML329_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ML329_ARATH
UniProt AC	Q9ZVF2
Protein Name	MLP-like protein 329
Gene Name	MLP329
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	151
Subcellular Localization
Protein Description
Protein Sequence	MATSGTYVTEVPLKGSADKHYKRWRDENHLFPDAIGHHIQGVTVHDGEWDSHEAIKIWNYTCDGKPEVFKERKEIDDENMVITFRGLEGHVMEQLKVYDLIYQFSQKSPDDIVCKITMIWEKRTDDSPEPSNYMKFLKSVVADMDEHVLKA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
7	Phosphorylation	-MATSGTYVTEVPLK -CCCCCEEEEEEECC	14.65	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ML329_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ML329_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ML329_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
NACA1_ARATH	AT3G12390	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ML329_ARATH

Related Literatures of Post-Translational Modification