dbPTM

NACA1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NACA1_ARATH
UniProt AC	Q9LHG9
Protein Name	Nascent polypeptide-associated complex subunit alpha-like protein 1
Gene Name	At3g12390
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	203
Subcellular Localization
Protein Description	May promote appropriate targeting of ribosome-nascent polypeptide complexes..
Protein Sequence	MTTEEKEILAAKLEEQKIDLDKPEVEDDDDNEDDDSDDDDKDDDEADGLDGEAGGKSKQSRSEKKSRKAMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASDTYVIFGEAKIEDLSSQIQSQAAEQFKAPDLSNVISKGESSSAAVVQDDEEVDEEGVEPKDIELVMTQAGVSRPNAVKALKAADGDIVSAIMELTT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	DDNEDDDSDDDDKDD CCCCCCCCCCCCCCC	50.35	30291188
57	Phosphorylation	DGEAGGKSKQSRSEK CCCCCCCCCCCHHHH	38.92	19376835
75	Sulfoxidation	KAMLKLGMKPITGVS HHHHHHCCCCCCCCE	7.27	23289948
139	Phosphorylation	QFKAPDLSNVISKGE HHCCCCHHHHHCCCC	36.11	27288362
143	Phosphorylation	PDLSNVISKGESSSA CCHHHHHCCCCCCCC	30.26	27288362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NACA1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NACA1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NACA1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NACA1_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-36, AND MASSSPECTROMETRY.	19376835 [Abstract]