| UniProt ID | MID49_HUMAN | |
|---|---|---|
| UniProt AC | Q96C03 | |
| Protein Name | Mitochondrial dynamics protein MID49 | |
| Gene Name | MIEF2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 454 | |
| Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . Colocalizes with DNM1L at mitochondrial membrane. Forms foci and rings around mitochondria. |
|
| Protein Description | Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity.. | |
| Protein Sequence | MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDAGTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCHFNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Ubiquitination | -MAEFSQKRGKRRSD -CCCHHHHHCCCCCC | 63.02 | - | |
| 13 | Phosphorylation | QKRGKRRSDEGLGSM HHHCCCCCCCCHHHH | 44.01 | 18669648 | |
| 64 | Ubiquitination | PRDEDDTKADSWKEL CCCCCCCCCCCHHHH | 58.13 | 23000965 | |
| 64 (in isoform 2) | Ubiquitination | - | 58.13 | 21890473 | |
| 64 (in isoform 1) | Ubiquitination | - | 58.13 | 21890473 | |
| 67 | Phosphorylation | EDDTKADSWKELSLL CCCCCCCCHHHHHHH | 44.93 | 26471730 | |
| 69 (in isoform 2) | Ubiquitination | - | 53.37 | 21890473 | |
| 69 (in isoform 1) | Ubiquitination | - | 53.37 | 21890473 | |
| 69 | Ubiquitination | DTKADSWKELSLLKA CCCCCCHHHHHHHHC | 53.37 | 23000965 | |
| 71 | Ubiquitination | KADSWKELSLLKATP CCCCHHHHHHHHCCC | 3.77 | 23000965 | |
| 72 | Phosphorylation | ADSWKELSLLKATPH CCCHHHHHHHHCCCC | 32.52 | 24719451 | |
| 75 | Ubiquitination | WKELSLLKATPHLQP HHHHHHHHCCCCCCC | 56.35 | 23000965 | |
| 76 | Ubiquitination | KELSLLKATPHLQPR HHHHHHHCCCCCCCC | 26.74 | 21890473 | |
| 80 | Ubiquitination | LLKATPHLQPRPPPA HHHCCCCCCCCCCCC | 8.69 | 21890473 | |
| 82 | Ubiquitination | KATPHLQPRPPPAAL HCCCCCCCCCCCCHH | 58.04 | 23000965 | |
| 86 | Ubiquitination | HLQPRPPPAALSQPV CCCCCCCCCHHCCCC | 32.61 | 23000965 | |
| 163 | Phosphorylation | IALELQAYFRSKFPE HHHHHHHHHHHHCCC | 6.12 | 21394647 | |
| 167 | Ubiquitination | LQAYFRSKFPELPFG HHHHHHHHCCCCCCC | 61.76 | - | |
| 430 | Phosphorylation | PSVNLFSSLREEEID CCCCHHHHCCHHHHC | 24.90 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MID49_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MID49_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MID49_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PRAF1_HUMAN | RABAC1 | physical | 19060904 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-13, AND MASSSPECTROMETRY. | |