| UniProt ID | MET14_HUMAN | |
|---|---|---|
| UniProt AC | Q9HCE5 | |
| Protein Name | N6-adenosine-methyltransferase non-catalytic subunit {ECO:0000305} | |
| Gene Name | METTL14 {ECO:0000312|HGNC:HGNC:29330} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 456 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some mRNAs and regulates the circadian clock, differentiation of embryonic stem cells and cortical neurogenesis. [PubMed: 24316715] | |
| Protein Sequence | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Phosphorylation | AQQLGAESADSIGAV HHHHCCCCHHHHHHH | 36.52 | 24173317 | |
| 30 | Phosphorylation | LGAESADSIGAVLNS HCCCCHHHHHHHHCC | 23.73 | 28348404 | |
| 38 | Ubiquitination | IGAVLNSKDEQREIA HHHHHCCHHHHHHHH | 65.30 | 21906983 | |
| 54 | Phosphorylation | TRETCRASYDTSAPN HHHHHHHHCCCCCCC | 12.28 | 28796482 | |
| 55 | Phosphorylation | RETCRASYDTSAPNA HHHHHHHCCCCCCCC | 23.43 | 28796482 | |
| 57 | Phosphorylation | TCRASYDTSAPNAKR HHHHHCCCCCCCCCH | 20.68 | 28796482 | |
| 58 | Phosphorylation | CRASYDTSAPNAKRK HHHHCCCCCCCCCHH | 38.54 | 28796482 | |
| 63 | Acetylation | DTSAPNAKRKYLDEG CCCCCCCCHHHCCCC | 56.94 | 25953088 | |
| 72 | Phosphorylation | KYLDEGETDEDKMEE HHCCCCCCCHHHHHH | 56.39 | 25849741 | |
| 80 | Phosphorylation | DEDKMEEYKDELEMQ CHHHHHHHHHHHHHH | 15.50 | 23898821 | |
| 95 | Phosphorylation | QDEENLPYEEEIYKD CCCCCCCCCHHHHCC | 38.86 | - | |
| 100 | Phosphorylation | LPYEEEIYKDSSTFL CCCCHHHHCCCCHHH | 16.42 | - | |
| 108 | Ubiquitination | KDSSTFLKGTQSLNP CCCCHHHCCCCCCCC | 56.58 | 29967540 | |
| 148 | Ubiquitination | DRFEEYPKLRELIRL HHHHHCHHHHHHHHH | 60.31 | 27667366 | |
| 148 | Acetylation | DRFEEYPKLRELIRL HHHHHCHHHHHHHHH | 60.31 | 25953088 | |
| 156 | Ubiquitination | LRELIRLKDELIAKS HHHHHHHHHHHHHCC | 39.03 | 27667366 | |
| 185 | Ubiquitination | DIRELTPKFDVILLE CHHHHCCCCCEEEEC | 49.30 | 29967540 | |
| 272 | Phosphorylation | NKNNPGKTKTLDPKA CCCCCCCCCCCCHHH | 34.87 | 20068231 | |
| 278 | Ubiquitination | KTKTLDPKAVFQRTK CCCCCCHHHHHHHHH | 57.77 | - | |
| 297 | Ubiquitination | MGIKGTVKRSTDGDF CCCCCEEEECCCCCC | 40.23 | 24816145 | |
| 351 | Phosphorylation | LHLFGRDSTIRPGWL HHHCCCCCCCCCCEE | 25.11 | 23909892 | |
| 352 | Phosphorylation | HLFGRDSTIRPGWLT HHCCCCCCCCCCEEE | 25.87 | 23909892 | |
| 399 | Phosphorylation | IERLRPKSPPPKSKS HHHHCCCCCCCCCCC | 45.37 | 30266825 | |
| 421 | Phosphorylation | RGGGRGGTSAGRGRE CCCCCCCCCCCCCCC | 20.44 | 25278378 | |
| 422 | Phosphorylation | GGGRGGTSAGRGRER CCCCCCCCCCCCCCC | 31.81 | 25278378 | |
| 442 | Methylation | RGERGGFRGGRGGAH CCCCCCCCCCCCCCC | 50.35 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET14_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET14_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET14_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SNX15_HUMAN | SNX15 | physical | 22939629 | |
| SNF8_HUMAN | SNF8 | physical | 22939629 | |
| DDI2_HUMAN | DDI2 | physical | 26344197 | |
| MTA70_HUMAN | METTL3 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...