UniProt ID | MET14_HUMAN | |
---|---|---|
UniProt AC | Q9HCE5 | |
Protein Name | N6-adenosine-methyltransferase non-catalytic subunit {ECO:0000305} | |
Gene Name | METTL14 {ECO:0000312|HGNC:HGNC:29330} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 456 | |
Subcellular Localization | Nucleus . | |
Protein Description | The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some mRNAs and regulates the circadian clock, differentiation of embryonic stem cells and cortical neurogenesis. [PubMed: 24316715] | |
Protein Sequence | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | AQQLGAESADSIGAV HHHHCCCCHHHHHHH | 36.52 | 24173317 | |
30 | Phosphorylation | LGAESADSIGAVLNS HCCCCHHHHHHHHCC | 23.73 | 28348404 | |
38 | Ubiquitination | IGAVLNSKDEQREIA HHHHHCCHHHHHHHH | 65.30 | 21906983 | |
54 | Phosphorylation | TRETCRASYDTSAPN HHHHHHHHCCCCCCC | 12.28 | 28796482 | |
55 | Phosphorylation | RETCRASYDTSAPNA HHHHHHHCCCCCCCC | 23.43 | 28796482 | |
57 | Phosphorylation | TCRASYDTSAPNAKR HHHHHCCCCCCCCCH | 20.68 | 28796482 | |
58 | Phosphorylation | CRASYDTSAPNAKRK HHHHCCCCCCCCCHH | 38.54 | 28796482 | |
63 | Acetylation | DTSAPNAKRKYLDEG CCCCCCCCHHHCCCC | 56.94 | 25953088 | |
72 | Phosphorylation | KYLDEGETDEDKMEE HHCCCCCCCHHHHHH | 56.39 | 25849741 | |
80 | Phosphorylation | DEDKMEEYKDELEMQ CHHHHHHHHHHHHHH | 15.50 | 23898821 | |
95 | Phosphorylation | QDEENLPYEEEIYKD CCCCCCCCCHHHHCC | 38.86 | - | |
100 | Phosphorylation | LPYEEEIYKDSSTFL CCCCHHHHCCCCHHH | 16.42 | - | |
108 | Ubiquitination | KDSSTFLKGTQSLNP CCCCHHHCCCCCCCC | 56.58 | 29967540 | |
148 | Ubiquitination | DRFEEYPKLRELIRL HHHHHCHHHHHHHHH | 60.31 | 27667366 | |
148 | Acetylation | DRFEEYPKLRELIRL HHHHHCHHHHHHHHH | 60.31 | 25953088 | |
156 | Ubiquitination | LRELIRLKDELIAKS HHHHHHHHHHHHHCC | 39.03 | 27667366 | |
185 | Ubiquitination | DIRELTPKFDVILLE CHHHHCCCCCEEEEC | 49.30 | 29967540 | |
272 | Phosphorylation | NKNNPGKTKTLDPKA CCCCCCCCCCCCHHH | 34.87 | 20068231 | |
278 | Ubiquitination | KTKTLDPKAVFQRTK CCCCCCHHHHHHHHH | 57.77 | - | |
297 | Ubiquitination | MGIKGTVKRSTDGDF CCCCCEEEECCCCCC | 40.23 | 24816145 | |
351 | Phosphorylation | LHLFGRDSTIRPGWL HHHCCCCCCCCCCEE | 25.11 | 23909892 | |
352 | Phosphorylation | HLFGRDSTIRPGWLT HHCCCCCCCCCCEEE | 25.87 | 23909892 | |
399 | Phosphorylation | IERLRPKSPPPKSKS HHHHCCCCCCCCCCC | 45.37 | 30266825 | |
421 | Phosphorylation | RGGGRGGTSAGRGRE CCCCCCCCCCCCCCC | 20.44 | 25278378 | |
422 | Phosphorylation | GGGRGGTSAGRGRER CCCCCCCCCCCCCCC | 31.81 | 25278378 | |
442 | Methylation | RGERGGFRGGRGGAH CCCCCCCCCCCCCCC | 50.35 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNX15_HUMAN | SNX15 | physical | 22939629 | |
SNF8_HUMAN | SNF8 | physical | 22939629 | |
DDI2_HUMAN | DDI2 | physical | 26344197 | |
MTA70_HUMAN | METTL3 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...