MESD_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MESD_MOUSE
• UniProt AC: Q9ERE7
• Protein Name: LRP chaperone MESD {ECO:0000305}
• Gene Name: Mesd {ECO:0000312|MGI:MGI:1891421}
• Organism: Mus musculus (Mouse).
• Sequence Length: 224
• Subcellular Localization: Endoplasmic reticulum . Released from apoptotic cells and shed photoreceptor outer segments (PubMed:27184668).
• Protein Description: Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. [PubMed: 12581525 Plays an essential role in neuromuscular junction (NMJ) formation by promoting cell-surface expression of LRP4]
• Protein Sequence: MAASRWLRAVLLFLCASDLLLLPPPNAYAADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRREDL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Phosphorylation	LPEHKRPSAPIDFSK CCCCCCCCCCCCHHH	51.19	28464351
192	N-linked_Glycosylation	GGGSKEKNKTKPEKA CCCCCCCCCCCHHHH	59.32	-
211	Phosphorylation	GDPKPRASKEDNRAG CCCCCCCCCCCCCCC	37.55	27841257

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MESD_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MESD_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MESD_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LRP6_MOUSE	Lrp6	physical	16126904
LRP6_MOUSE	Lrp6	physical	18505367
LRP6_MOUSE	Lrp6	physical	16263759

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.