MCES_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MCES_SCHPO
• UniProt AC: O74880
• Protein Name: mRNA cap guanine-N7 methyltransferase
• Gene Name: pcm1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 360
• Subcellular Localization: Nucleus .
• Protein Description: Responsible for methylating the 5'-cap structure of mRNAs..
• Protein Sequence: MSSSNSRVHEEQPPTENRRYARPTAQMNRVIEQQPRRRDYFQNNDNSGRRGYNRHENNGNAQDVVRSHYNARPDLGYKKRQFSPIIQLKRFNNWIKSVLIQKFAPHASDYPILVLDMGCGKGGDLIKWDKAGIDGYIGIDIAEVSVNQAKKRYREMHASFDALFYAGDCFSSSINELLPPDQRKFDVVSLQFCMHYAFESEEKVRVLLGNVSKCLPRGGVMIGTIPNSDVIVKHIKMLKPGEKEWGNDIYKVRFPESPPRSFRPPYGIQYYFYLEDAVTDVPEYVVPFEAFRAVAEGYNLELIWVKPFLDILNEEKNSETYGPLMDRMKVVDNEGHRGIGGQEKEAAGFYLAFAFEKRGI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
257	Phosphorylation	YKVRFPESPPRSFRP EEEECCCCCCCCCCC	40.20	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MCES_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MCES_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MCES_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK9_SCHPO	cdk9	physical	22508988
CG1C_SCHPO	pch1	physical	22508988
CDK9_SCHPO	cdk9	genetic	22508988

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.