| UniProt ID | MCEE_HUMAN | |
|---|---|---|
| UniProt AC | Q96PE7 | |
| Protein Name | Methylmalonyl-CoA epimerase, mitochondrial | |
| Gene Name | MCEE | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 176 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 | Acetylation | IAVPDLEKAAAFYKN EECCCHHHHHHHHHH | 51.10 | 25953088 | |
| 114 | Acetylation | PIAGFLQKNKAGGMH CCHHHHHHCCCCCCC | 63.66 | 19608861 | |
| 114 | Succinylation | PIAGFLQKNKAGGMH CCHHHHHHCCCCCCC | 63.66 | - | |
| 114 | Malonylation | PIAGFLQKNKAGGMH CCHHHHHHCCCCCCC | 63.66 | 26320211 | |
| 114 | Succinylation | PIAGFLQKNKAGGMH CCHHHHHHCCCCCCC | 63.66 | 27452117 | |
| 150 | Acetylation | RSLSEEVKIGAHGKP HHHCCCEEECCCCCE | 38.41 | 25953088 | |
| 150 | Succinylation | RSLSEEVKIGAHGKP HHHCCCEEECCCCCE | 38.41 | - | |
| 150 | Malonylation | RSLSEEVKIGAHGKP HHHCCCEEECCCCCE | 38.41 | 26320211 | |
| 150 | Succinylation | RSLSEEVKIGAHGKP HHHCCCEEECCCCCE | 38.41 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCEE_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCEE_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCEE_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| CKLF5_HUMAN | CMTM5 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 251120 | Methylmalonyl-CoA epimerase deficiency (MCEED) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-114, AND MASS SPECTROMETRY. | |