UniProt ID | MAAI_HUMAN | |
---|---|---|
UniProt AC | O43708 | |
Protein Name | Maleylacetoacetate isomerase | |
Gene Name | GSTZ1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 216 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.. | |
Protein Sequence | MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MQAGKPIL -------CCCCCCCC | 5.78 | 22814378 | |
9 | Phosphorylation | QAGKPILYSYFRSSC CCCCCCCHHHHHHHC | 11.31 | 21406692 | |
10 | Phosphorylation | AGKPILYSYFRSSCS CCCCCCHHHHHHHCC | 17.85 | 21406692 | |
11 | Phosphorylation | GKPILYSYFRSSCSW CCCCCHHHHHHHCCH | 6.88 | 21406692 | |
32 | Acetylation | ALKGIDYKTVPINLI HHCCCCCCEEEHHHC | 39.02 | 19608861 | |
32 | Succinylation | ALKGIDYKTVPINLI HHCCCCCCEEEHHHC | 39.02 | 23954790 | |
57 | Malonylation | FQALNPMKQVPTLKI HHHCCCCCCCCEEEE | 49.77 | 26320211 | |
57 | Succinylation | FQALNPMKQVPTLKI HHHCCCCCCCCEEEE | 49.77 | - | |
57 | Succinylation | FQALNPMKQVPTLKI HHHCCCCCCCCEEEE | 49.77 | - | |
57 | Acetylation | FQALNPMKQVPTLKI HHHCCCCCCCCEEEE | 49.77 | 25953088 | |
61 | Phosphorylation | NPMKQVPTLKIDGIT CCCCCCCEEEECCEE | 41.65 | 24043423 | |
68 | Phosphorylation | TLKIDGITIHQSLAI EEEECCEEEHHHHHH | 20.24 | 24043423 | |
72 | Phosphorylation | DGITIHQSLAIIEYL CCEEEHHHHHHHHHH | 12.95 | 24043423 | |
78 | Phosphorylation | QSLAIIEYLEEMRPT HHHHHHHHHHHHCCC | 14.70 | 24043423 | |
94 | 2-Hydroxyisobutyrylation | RLLPQDPKKRASVRM CCCCCCHHHHHHHHH | 64.28 | - | |
136 | Phosphorylation | TWAQNAITCGFNALE HHHHHHHHHCHHHHH | 12.26 | - | |
177 | Succinylation | VANAERFKVDLTPYP CCCCCCCCCCCCCCC | 40.85 | - | |
177 | Succinylation | VANAERFKVDLTPYP CCCCCCCCCCCCCCC | 40.85 | - | |
181 | Phosphorylation | ERFKVDLTPYPTISS CCCCCCCCCCCCHHH | 19.13 | 29083192 | |
183 | Phosphorylation | FKVDLTPYPTISSIN CCCCCCCCCCHHHHH | 14.05 | 29083192 | |
185 | Phosphorylation | VDLTPYPTISSINKR CCCCCCCCHHHHHHH | 27.87 | 24275569 | |
187 | Phosphorylation | LTPYPTISSINKRLL CCCCCCHHHHHHHHH | 27.87 | 24275569 | |
188 | Phosphorylation | TPYPTISSINKRLLV CCCCCHHHHHHHHHH | 26.74 | 24275569 | |
191 | Acetylation | PTISSINKRLLVLEA CCHHHHHHHHHHEEH | 42.63 | 24888325 | |
212 | Phosphorylation | CRQPDTPTELRA--- CCCCCCCCCCCC--- | 50.14 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAAI_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAAI_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAAI_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAAI_HUMAN | GSTZ1 | physical | 16189514 | |
MAAI_HUMAN | GSTZ1 | physical | 25416956 | |
PRDX6_HUMAN | PRDX6 | physical | 26344197 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00143 | Glutathione |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-32, AND MASS SPECTROMETRY. |