dbPTM

M1IP1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	M1IP1_MOUSE
UniProt AC	Q9CQ20
Protein Name	Mid1-interacting protein 1
Gene Name	Mid1ip1
Organism	Mus musculus (Mouse).
Sequence Length	182
Subcellular Localization	Nucleus . Cytoplasm . Cytoplasm, cytoskeleton . Associated with microtubules (PubMed:15070402).
Protein Description	Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules..
Protein Sequence	MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLSEPEIDEVSVEVGGSGGCLEERTTPAPSPGSANESFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPSSPPAGSEESTWKPKDILVGLSHLESADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFSNWGH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MMQICDTY -------CCCCCCCC	3.93	-
31	Phosphorylation	AVNNMDQTVMVPSLL HHHCCCCEEECCHHH	13.30	29899451
44	Phosphorylation	LLRDVPLSEPEIDEV HHCCCCCCCCCCCEE	45.06	26525534
66	Phosphorylation	GGCLEERTTPAPSPG CCCCCCCCCCCCCCC	40.17	25521595
67	Phosphorylation	GCLEERTTPAPSPGS CCCCCCCCCCCCCCC	24.55	25521595
71	Phosphorylation	ERTTPAPSPGSANES CCCCCCCCCCCCCCC	43.96	25521595
74	Phosphorylation	TPAPSPGSANESFFA CCCCCCCCCCCCCCC	31.16	25521595
78	Phosphorylation	SPGSANESFFAPSRD CCCCCCCCCCCCCHH	26.02	25619855
83	Phosphorylation	NESFFAPSRDMYSHY CCCCCCCCHHHHHHH	37.17	25619855
95	Phosphorylation	SHYVLLKSIRNDIEW HHHHHHHHHHCCCCC	27.10	23984901
109	Phosphorylation	WGVLHQPSSPPAGSE CCCCCCCCCCCCCCC	49.24	26643407
110	Phosphorylation	GVLHQPSSPPAGSEE CCCCCCCCCCCCCCC	41.40	23984901
115	Phosphorylation	PSSPPAGSEESTWKP CCCCCCCCCCCCCCH	40.05	26643407
118	Phosphorylation	PPAGSEESTWKPKDI CCCCCCCCCCCHHHE	35.20	25266776
119	Phosphorylation	PAGSEESTWKPKDIL CCCCCCCCCCHHHEE	40.56	23984901
163	Ubiquitination	VLSKLTRKANILTNR HHHHHHHHHCHHCHH	40.32	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of M1IP1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of M1IP1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of M1IP1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TRI18_MOUSE	Mid1	physical	15070402

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of M1IP1_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-67 AND SER-74, AND MASSSPECTROMETRY.	17242355 [Abstract]