| UniProt ID | M1AP_HUMAN | |
|---|---|---|
| UniProt AC | Q8TC57 | |
| Protein Name | Meiosis 1 arrest protein | |
| Gene Name | M1AP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 530 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Required for meiosis I progression during spermatogenesis.. | |
| Protein Sequence | MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTSLEITILTSQPGKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQTIDNDIVSMEIFFKAWLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGSLRMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHFHALCHSLLKREWLLLAKGEPPGPGHSQRIPASTFYVIMPSHSLTLLVKAVATRELMLPSTFPLLPEDPHDDSLKNVESMLDSLELEPTYNPLHVQSHLYSHLSSIYAKPQGRLHPHWESRAPRKHPCKTGQLQTNRARATVAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEKDPSRP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Ubiquitination | HPGRTTGKGPSTHTQ CCCCCCCCCCCCCCC | 21906983 | ||
| 9 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 9 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 9 | Ubiquitination | HPGRTTGKGPSTHTQ CCCCCCCCCCCCCCC | 21906983 | ||
| 13 | Phosphorylation | TTGKGPSTHTQIDQQ CCCCCCCCCCCCCCC | - | ||
| 29 (in isoform 3) | Ubiquitination | - | 21906983 | ||
| 62 | Phosphorylation | LMGPSRMSLFSLYMV HHCCCHHHHHHHEEC | - | ||
| 94 | Phosphorylation | ARLQTCISELRMLQR HHHHHHHHHHHHHHH | 24719451 | ||
| 124 | Ubiquitination | EDGLQQFKQYSRHVT HHHHHHHHHHHHHHH | 21906983 | ||
| 124 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 124 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 132 | Phosphorylation | QYSRHVTTRAALTYT HHHHHHHHHHCCEEE | 30576142 | ||
| 147 | Phosphorylation | SLEITILTSQPGKEV EEEEEEEECCCCHHH | 30576142 | ||
| 156 | Ubiquitination | QPGKEVVKQLEEGLK CCCHHHHHHHHHHCC | 21906983 | ||
| 156 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 156 | Ubiquitination | QPGKEVVKQLEEGLK CCCHHHHHHHHHHCC | - | ||
| 156 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 160 (in isoform 3) | Ubiquitination | - | 21906983 | ||
| 163 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 163 | Ubiquitination | KQLEEGLKDTDLARV HHHHHHCCCCCHHHH | 21906983 | ||
| 163 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 163 | Ubiquitination | KQLEEGLKDTDLARV HHHHHHCCCCCHHHH | - | ||
| 165 | Phosphorylation | LEEGLKDTDLARVRR HHHHCCCCCHHHHEE | 23909892 | ||
| 174 (in isoform 3) | Ubiquitination | - | 21906983 | ||
| 311 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 311 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 311 | Ubiquitination | HYKLQVIKALKSSGL HHHHHHHHHHHHCCC | 21906983 | ||
| 311 | Ubiquitination | HYKLQVIKALKSSGL HHHHHHHHHHHHCCC | - | ||
| 356 | Phosphorylation | HFHALCHSLLKREWL HHHHHHHHHHHHHHH | 24719451 | ||
| 490 | Phosphorylation | QTNRARATVAPLPMT CCCCCCCEEECCCCC | 28152594 | ||
| 497 | Phosphorylation | TVAPLPMTPVPGRAS EEECCCCCCCCCCCC | 28152594 | ||
| 504 | Phosphorylation | TPVPGRASKMPAASK CCCCCCCCCCCCCCC | 28152594 | ||
| 507 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 507 | Ubiquitination | PGRASKMPAASKSSS CCCCCCCCCCCCCCC | - | ||
| 511 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 511 | Ubiquitination | SKMPAASKSSSDAFF CCCCCCCCCCCCCCC | 2190698 | ||
| 521 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 521 | Ubiquitination | SDAFFLPSEWEKDPS CCCCCCCHHHCCCCC | - | ||
| 525 | Ubiquitination | FLPSEWEKDPSRP-- CCCHHHCCCCCCC-- | - | ||
| 525 (in isoform 1) | Ubiquitination | - | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of M1AP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of M1AP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of M1AP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| M1AP_HUMAN | M1AP | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
