LYS5_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LYS5_YEAST
• UniProt AC: P50113
• Protein Name: L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
• Gene Name: LYS5
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 272
• Protein Description: Catalyzes the transfer of a 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acceptor proteins, such as alpha-aminoadipate reductase. Necessary for alpha-aminoadipate reductase activity..
• Protein Sequence: MVKTTEVVSEVSKVAGVRPWAGIFVVEIQEDILADEFTFEALMRTLPLASQARILNKKSFHDRCSNLCSQLLQLFGCSIVTGLNFQELKFDKGSFGKPFLDNNRFLPFSMTIGEQYVAMFLVKCVSTDEYQDVGIDIASPCNYGGREELELFKEVFSEREFNGLLKASDPCTIFTYLWSLKESYTKFTGTGLNTDLSLIDFGAISFFPAEGASMCITLDEVPLIFHSQWFNNEIVTICMPKSISDKINTNRPKLYNISLSTLIDYFIENDGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MVKTTEVVSEV ----CCCCHHHHHHH	19.44	28889911
12	Phosphorylation	TEVVSEVSKVAGVRP HHHHHHHHHHHCCCC	19.84	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LYS5_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LYS5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LYS5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FZF1_YEAST	FZF1	physical	10688190
FZF1_YEAST	FZF1	physical	11283351
PUR6_YEAST	ADE2	physical	11283351

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.