| UniProt ID | LY6D_HUMAN | |
|---|---|---|
| UniProt AC | Q14210 | |
| Protein Name | Lymphocyte antigen 6D | |
| Gene Name | LY6D | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 128 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
| Protein Description | May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification.. | |
| Protein Sequence | MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MRTALLLLAA -----CHHHHHHHHH | 21.99 | 24043423 | |
| 15 | Phosphorylation | LAALAVATGPALTLR HHHHHHHHCCCEEEE | 36.78 | 24043423 | |
| 20 | Phosphorylation | VATGPALTLRCHVCT HHHCCCEEEEEEEEC | 17.79 | 27762562 | |
| 68 | Phosphorylation | KDCAESCTPSYTLQG HHHHHHCCCCEEEEE | 25.25 | 22210691 | |
| 71 | Phosphorylation | AESCTPSYTLQGQVS HHHCCCCEEEEEEEC | 16.81 | 22210691 | |
| 78 | Phosphorylation | YTLQGQVSSGTSSTQ EEEEEEECCCCCCCC | 18.37 | 22210691 | |
| 98 | GPI-anchor | LCNEKLHNAAPTRTA HCCHHHHCCCCHHHH | 48.51 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LY6D_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LY6D_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LY6D_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IPKB_HUMAN | PKIB | physical | 21988832 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
