IPKB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IPKB_HUMAN
• UniProt AC: Q9C010
• Protein Name: cAMP-dependent protein kinase inhibitor beta
• Gene Name: PKIB
• Organism: Homo sapiens (Human).
• Sequence Length: 78
• Protein Description: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains..
• Protein Sequence: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MRTDSSKMTDVE ---CCCCHHHCCCHH	31.11	24719451
6	Phosphorylation	--MRTDSSKMTDVES --CCCCHHHCCCHHH	29.29	29116813
9	Phosphorylation	RTDSSKMTDVESGVA CCCHHHCCCHHHHHH	40.40	29116813
12	Phosphorylation	SSKMTDVESGVANFA HHHCCCHHHHHHHHH	44.58	27251275
20	Phosphorylation	SGVANFASSARAGRR HHHHHHHHHHHCCCC	22.01	28348404
21	Phosphorylation	GVANFASSARAGRRN HHHHHHHHHHCCCCC	20.53	28348404
27	Phosphorylation	SSARAGRRNALPDIQ HHHHCCCCCCCCCHH	31.68	27251275
48	Ubiquitination	GTSDLPLKLEALSVK CCCCCCCCEEEEECC	42.20	2190698
53	Phosphorylation	PLKLEALSVKEDAKE CCCEEEEECCHHHHH	37.89	23401153
55	Ubiquitination	KLEALSVKEDAKEKD CEEEEECCHHHHHHC	46.64	29967540
60	Phosphorylation	SVKEDAKEKDEKTTQ ECCHHHHHHCCCCCH	68.41	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IPKB_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IPKB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IPKB_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of IPKB_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.