LSM7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LSM7_SCHPO
• UniProt AC: O74499
• Protein Name: U6 snRNA-associated Sm-like protein LSm7
• Gene Name: lsm7
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 113
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Probable component of the spliceosome..
• Protein Sequence: MSSLQKRPGPGNSSQPTERPRKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPEDGKLTGAIRKLGLVVVRGTTLVLIAPMDGSEEIPNPFVQAE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	TERPRKESILDLSRY CCCCCCCCHHHHHHH	31.33	25720772
41	Phosphorylation	QRIQATFTGGRQITG HCEEEEECCCHHHHH	34.08	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LSM7_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LSM7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LSM7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LSM7_SCHPO	lsm7	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.