LSM5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LSM5_SCHPO
• UniProt AC: O42978
• Protein Name: U6 snRNA-associated Sm-like protein LSm5
• Gene Name: lsm5
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 80
• Subcellular Localization: Nucleus .
• Protein Description: Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. LSm5 is required for processing of pre-tRNAs, pre-rRNAs and U3 snoRNA (By similarity)..
• Protein Sequence: MSMTILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGKPE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of LSM5_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LSM5_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LSM5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LSM5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LSM6_SCHPO	lsm6	physical	22615807
LSM7_SCHPO	lsm7	physical	22615807
YHP4_SCHPO	rmn1	physical	26771498
LSM7_SCHPO	lsm7	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.