UniProt ID | LRC57_HUMAN | |
---|---|---|
UniProt AC | Q8N9N7 | |
Protein Name | Leucine-rich repeat-containing protein 57 | |
Gene Name | LRRC57 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 239 | |
Subcellular Localization |
Membrane Lipid-anchor . |
|
Protein Description | ||
Protein Sequence | MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKKFA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNSALRAH ------CCCHHHHHH | 36.48 | 25255805 | |
15 | Ubiquitination | AHVETAQKTGVFQLK HHHHHHHHHCCEEEC | 44.79 | - | |
16 | Phosphorylation | HVETAQKTGVFQLKD HHHHHHHHCCEEECC | 26.88 | - | |
22 | Ubiquitination | KTGVFQLKDRGLTEF HHCCEEECCCCCCCC | 34.30 | - | |
35 | Ubiquitination | EFPADLQKLTSNLRT CCCHHHHHHHHCCEE | 62.11 | 21890473 | |
37 | Phosphorylation | PADLQKLTSNLRTID CHHHHHHHHCCEEEE | 23.70 | 20068231 | |
38 | Phosphorylation | ADLQKLTSNLRTIDL HHHHHHHHCCEEEEC | 44.28 | 20068231 | |
42 | Phosphorylation | KLTSNLRTIDLSNNK HHHHCCEEEECCCCC | 23.24 | 20068231 | |
46 | Phosphorylation | NLRTIDLSNNKIESL CCEEEECCCCCCCCC | 34.31 | 20068231 | |
49 | Ubiquitination | TIDLSNNKIESLPPL EEECCCCCCCCCCCC | 52.69 | - | |
52 | Phosphorylation | LSNNKIESLPPLLIG CCCCCCCCCCCCEEC | 50.04 | 21406692 | |
60 | Ubiquitination | LPPLLIGKFTLLKSL CCCCEECCEEEEEEE | 28.34 | - | |
62 | Phosphorylation | PLLIGKFTLLKSLSL CCEECCEEEEEEECC | 34.37 | - | |
85 | Ubiquitination | PDEICNLKKLETLSL CHHHHCCCCCCEEEC | 41.12 | - | |
86 | Ubiquitination | DEICNLKKLETLSLN HHHHCCCCCCEEECC | 55.51 | - | |
140 | Ubiquitination | LDVMDLSKNQIRSIP CCHHCCCHHHHHCCC | 61.23 | 21890473 | |
226 | Ubiquitination | RELEGYDKYMERFTA HHHCCHHHHHHHHHH | 37.70 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC57_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC57_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC57_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CE030_HUMAN | C5orf30 | physical | 28514442 | |
LRC40_HUMAN | LRRC40 | physical | 28514442 | |
SGT1_HUMAN | SUGT1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...