UniProt ID | LRC51_HUMAN | |
---|---|---|
UniProt AC | Q96E66 | |
Protein Name | Leucine-rich repeat-containing protein 51 | |
Gene Name | LRTOMT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 192 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 (in isoform 6) | Phosphorylation | - | 5.30 | 24043423 | |
9 (in isoform 6) | Phosphorylation | - | 17.47 | 24043423 | |
18 (in isoform 6) | Phosphorylation | - | 19.86 | 24043423 | |
22 | Phosphorylation | PLDYSFRSIHVIQDL CCCCCHHHHHHHHHH | 18.29 | 25693802 | |
22 (in isoform 2) | Phosphorylation | - | 18.29 | 25693802 | |
22 (in isoform 3) | Phosphorylation | - | 18.29 | 25693802 | |
22 (in isoform 4) | Phosphorylation | - | 18.29 | 25693802 | |
22 (in isoform 5) | Phosphorylation | - | 18.29 | 25693802 | |
35 (in isoform 6) | Phosphorylation | - | 44.71 | - | |
36 | Phosphorylation | LVNEEPRTGLRPLKR HHCCCCCCCCCCCCC | 51.81 | - | |
36 (in isoform 2) | Phosphorylation | - | 51.81 | - | |
36 (in isoform 3) | Phosphorylation | - | 51.81 | - | |
36 (in isoform 4) | Phosphorylation | - | 51.81 | - | |
36 (in isoform 5) | Phosphorylation | - | 51.81 | - | |
53 (in isoform 3) | Phosphorylation | - | 19.10 | - | |
53 (in isoform 5) | Phosphorylation | - | 19.10 | - | |
53 (in isoform 4) | Phosphorylation | - | 19.10 | - | |
53 | Phosphorylation | SGKSLTQSLWLNNNV CCCCHHHHHHHCCCH | 19.10 | - | |
53 (in isoform 2) | Phosphorylation | - | 19.10 | - | |
139 (in isoform 6) | Phosphorylation | - | 13.52 | - | |
140 (in isoform 6) | Phosphorylation | - | 65.35 | - | |
157 | Phosphorylation | LCTLSRITTFDFSGV EEEECCCEEECCCCC | 21.94 | - | |
158 | Phosphorylation | CTLSRITTFDFSGVT EEECCCEEECCCCCC | 20.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC51_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC51_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC51_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JOS2_HUMAN | JOSD2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...