| UniProt ID | LRC51_HUMAN | |
|---|---|---|
| UniProt AC | Q96E66 | |
| Protein Name | Leucine-rich repeat-containing protein 51 | |
| Gene Name | LRTOMT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 192 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | ||
| Protein Sequence | MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPMEEEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 (in isoform 6) | Phosphorylation | - | 5.30 | 24043423 | |
| 9 (in isoform 6) | Phosphorylation | - | 17.47 | 24043423 | |
| 18 (in isoform 6) | Phosphorylation | - | 19.86 | 24043423 | |
| 22 | Phosphorylation | PLDYSFRSIHVIQDL CCCCCHHHHHHHHHH | 18.29 | 25693802 | |
| 22 (in isoform 2) | Phosphorylation | - | 18.29 | 25693802 | |
| 22 (in isoform 3) | Phosphorylation | - | 18.29 | 25693802 | |
| 22 (in isoform 4) | Phosphorylation | - | 18.29 | 25693802 | |
| 22 (in isoform 5) | Phosphorylation | - | 18.29 | 25693802 | |
| 35 (in isoform 6) | Phosphorylation | - | 44.71 | - | |
| 36 | Phosphorylation | LVNEEPRTGLRPLKR HHCCCCCCCCCCCCC | 51.81 | - | |
| 36 (in isoform 2) | Phosphorylation | - | 51.81 | - | |
| 36 (in isoform 3) | Phosphorylation | - | 51.81 | - | |
| 36 (in isoform 4) | Phosphorylation | - | 51.81 | - | |
| 36 (in isoform 5) | Phosphorylation | - | 51.81 | - | |
| 53 (in isoform 3) | Phosphorylation | - | 19.10 | - | |
| 53 (in isoform 5) | Phosphorylation | - | 19.10 | - | |
| 53 (in isoform 4) | Phosphorylation | - | 19.10 | - | |
| 53 | Phosphorylation | SGKSLTQSLWLNNNV CCCCHHHHHHHCCCH | 19.10 | - | |
| 53 (in isoform 2) | Phosphorylation | - | 19.10 | - | |
| 139 (in isoform 6) | Phosphorylation | - | 13.52 | - | |
| 140 (in isoform 6) | Phosphorylation | - | 65.35 | - | |
| 157 | Phosphorylation | LCTLSRITTFDFSGV EEEECCCEEECCCCC | 21.94 | - | |
| 158 | Phosphorylation | CTLSRITTFDFSGVT EEECCCEEECCCCCC | 20.88 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC51_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC51_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC51_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| JOS2_HUMAN | JOSD2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...