UniProt ID | LPA2_ARATH | |
---|---|---|
UniProt AC | F4KDA6 | |
Protein Name | Protein LOW PSII ACCUMULATION 2, chloroplastic | |
Gene Name | LPA2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 185 | |
Subcellular Localization |
Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . |
|
Protein Description | Involved in assisting chlorophyll a binding protein psbC assembly within photosystem II (PSII). Works cooperatively with LPA3.. | |
Protein Sequence | MALQIHSPCSFSTRPYHLFFTTRNPRFAIKCQNSQIESDTTEDPSRSKNSSSSGVGFGSPASSSSPAKKLSAATSGNKKGKGKREVNRRAPVEKPVFMSEEGAAKAEEQRQNENAFLLTWLGLGIVILIEGIILAASGFLPEELDKLFVKYVYPVFTPSVVLFVAGTTAYGVLKYIQNEKMKGQE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | DPSRSKNSSSSGVGF CCCCCCCCCCCCCCC | 25561503 | ||
51 | Phosphorylation | PSRSKNSSSSGVGFG CCCCCCCCCCCCCCC | 25561503 | ||
52 | Phosphorylation | SRSKNSSSSGVGFGS CCCCCCCCCCCCCCC | 25561503 | ||
71 | Phosphorylation | SSPAKKLSAATSGNK CCHHHHHHHCCCCCC | 25561503 | ||
74 | Phosphorylation | AKKLSAATSGNKKGK HHHHHHCCCCCCCCC | 25561503 | ||
75 | Phosphorylation | KKLSAATSGNKKGKG HHHHHCCCCCCCCCC | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LPA2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LPA2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LPA2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LPA3_ARATH | LPA3 | physical | 20605914 | |
LPA2_ARATH | LPA2 | physical | 20605914 | |
ALB3_ARATH | ALB3 | physical | 20605914 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...