LITAF_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LITAF_MOUSE
• UniProt AC: Q9JLJ0
• Protein Name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
• Gene Name: Litaf
• Organism: Mus musculus (Mouse).
• Sequence Length: 161
• Subcellular Localization: Cytoplasm . Nucleus . Lysosome membrane ; Peripheral membrane protein ; Cytoplasmic side . Early endosome membrane . Late endosome membrane . Endosome membrane ; Peripheral membrane protein ; Cytoplasmic side . Cell membrane ; Peripheral membrane protein
• Protein Description: Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades. [PubMed: 23166352 Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4 (By similarity May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines]
• Protein Sequence: MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSAPGPYQA ------CCCCCCCCC	43.07	25338131
63	Phosphorylation	MNPPSYYTQPVPVPN CCCCHHCCCCCCCCC	20.40	24453211
80	Phosphorylation	AIAVQTVYVQQPVSF EEEEEEEEEECCCCC	8.91	29514104
159	Ubiquitination	KALLGTYKRL----- HHHHHHHCCC-----	47.24	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LITAF_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LITAF_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LITAF_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NEDD4_MOUSE	Nedd4	physical	11042109
STAT6_MOUSE	Stat6	physical	15793005

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.