UniProt ID | LITAF_MOUSE | |
---|---|---|
UniProt AC | Q9JLJ0 | |
Protein Name | Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog | |
Gene Name | Litaf | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 161 | |
Subcellular Localization |
Cytoplasm . Nucleus . Lysosome membrane Peripheral membrane protein Cytoplasmic side . Early endosome membrane . Late endosome membrane . Endosome membrane Peripheral membrane protein Cytoplasmic side . Cell membrane Peripheral membrane protein |
|
Protein Description | Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades. [PubMed: 23166352 Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4 (By similarity May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines] | |
Protein Sequence | MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSAPGPYQA ------CCCCCCCCC | 43.07 | 25338131 | |
63 | Phosphorylation | MNPPSYYTQPVPVPN CCCCHHCCCCCCCCC | 20.40 | 24453211 | |
80 | Phosphorylation | AIAVQTVYVQQPVSF EEEEEEEEEECCCCC | 8.91 | 29514104 | |
159 | Ubiquitination | KALLGTYKRL----- HHHHHHHCCC----- | 47.24 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LITAF_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LITAF_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LITAF_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NEDD4_MOUSE | Nedd4 | physical | 11042109 | |
STAT6_MOUSE | Stat6 | physical | 15793005 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...