LIN7A_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LIN7A_RAT
• UniProt AC: Q9Z250
• Protein Name: Protein lin-7 homolog A
• Gene Name: Lin7a
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 232
• Subcellular Localization: Cell membrane; Peripheral membrane protein. Basolateral cell membrane; Peripheral membrane protein. Cell junction. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density; Peripheral membrane protein. Cell junction, tight junction. Cell j
• Protein Description: Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells..
• Protein Sequence: MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQPQQNHMS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
91	Ubiquitination	FRARATAKATVAAFA HHHHHHHHHHHHHHH	39.99	-
93	Phosphorylation	ARATAKATVAAFAAS HHHHHHHHHHHHHHH	15.24	16641100
104	Phosphorylation	FAASEGHSHPRVVEL HHHHCCCCCCEEEEC	46.15	16641100
130	Phosphorylation	MGGKEQNSPIYISRI CCCCCCCCCEEEEEE	16.63	27097102
133	Phosphorylation	KEQNSPIYISRIIPG CCCCCCEEEEEECCC	9.02	25575281
232	Phosphorylation	QPQQNHMS------- CCHHHCCC-------	29.53	28689409

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LIN7A_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LIN7A_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LIN7A_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MARHB_RAT	March11	physical	17604280
MARH2_RAT	March2	physical	15689499

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.