dbPTM

MARHB_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MARHB_RAT
UniProt AC	A6P320
Protein Name	E3 ubiquitin-protein ligase MARCH11
Gene Name	11-Mar
Organism	Rattus norvegicus (Rat).
Sequence Length	398
Subcellular Localization	Cytoplasmic vesicle membrane Multi-pass membrane protein .
Protein Description	E3 ubiquitin-protein ligase that mediates polyubiquitination of CD4. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May play a role in ubuquitin-dependent protein sorting in developmenting spermatids..
Protein Sequence	MSDEGSKRGSRADSLEAEPPLPPPPPPPPPGESSLVPTSPRYRPPLPAPLERIVGSGEPPVELAPRRKGEPLPPLPPSRLPGDQEVSAAGDSCEGPRRLPEVKLPEAAAGKGSPAEPEAGACREGERRGTGDQPETRSVYSSRSSSSGGSGDQRSGHQHQHHQPICKICFQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMKQPCQWQSISITLVEKVQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALRNRNLVHPTQLTSPRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
146	Phosphorylation	VYSSRSSSSGGSGDQ CCCCCCCCCCCCCCC	33.96	26022182
334	Phosphorylation	EESSRGESSTSRTLW CHHCCCCCCCCCEEE	41.56	-
360	Phosphorylation	VHPTQLTSPRFQCGY CCCCCCCCCHHHHHH	23.75	30240740

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MARHB_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MARHB_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MARHB_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
AP1M1_RAT	Ap1m1	physical	17604280
LIN7C_RAT	Lin7c	physical	17604280

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MARHB_RAT

Related Literatures of Post-Translational Modification