LIN28_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LIN28_DROME
• UniProt AC: Q9VRN5
• Protein Name: Protein lin-28 homolog
• Gene Name: lin-28
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 195
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MENVQLENGLERRTTSQSSTSSANPANLASPTEECGCVRLGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTYRPRINRRTRRMRCYNCGEFANHIASECALGPQPKRCHRCRGEDHLHADCPHKNVTQSHSNSKSISNNSSSSAAQEKSEEAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	ENGLERRTTSQSSTS CCCCEECCCCCCCCC	36.70	22817900
15	Phosphorylation	NGLERRTTSQSSTSS CCCEECCCCCCCCCC	23.98	21082442
16	Phosphorylation	GLERRTTSQSSTSSA CCEECCCCCCCCCCC	27.70	21082442
18	Phosphorylation	ERRTTSQSSTSSANP EECCCCCCCCCCCCC	35.04	21082442
19	Phosphorylation	RRTTSQSSTSSANPA ECCCCCCCCCCCCCC	25.35	21082442
20	Phosphorylation	RTTSQSSTSSANPAN CCCCCCCCCCCCCCC	31.76	21082442
21	Phosphorylation	TTSQSSTSSANPANL CCCCCCCCCCCCCCC	29.42	21082442
108	Phosphorylation	VSSRHGGSCQGSTYR EECCCCCCCCCCCCC	14.09	21082442
113	Phosphorylation	GGSCQGSTYRPRINR CCCCCCCCCCCCCCC	30.30	22817900
177	Phosphorylation	QSHSNSKSISNNSSS CCCCCCCCCCCCCCC	30.94	21082442
183	Phosphorylation	KSISNNSSSSAAQEK CCCCCCCCCHHHHHH	30.36	22817900
184	Phosphorylation	SISNNSSSSAAQEKS CCCCCCCCHHHHHHH	24.66	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LIN28_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LIN28_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LIN28_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GUTR1_DROME	Tre1	physical	22036573
INSR_DROME	InR	genetic	26487778
INSR_DROME	InR	physical	26487778

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.