UniProt ID | LEU3_YEAST | |
---|---|---|
UniProt AC | P04173 | |
Protein Name | 3-isopropylmalate dehydrogenase | |
Gene Name | LEU2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 364 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the oxidation of 3-carboxy-2-hydroxy-4-methylpentanoate (3-isopropylmalate) to 3-carboxy-4-methyl-2-oxopentanoate. The product decarboxylates to 4-methyl-2 oxopentanoate.. | |
Protein Sequence | MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLPKNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTGDLGGSNSTTEVGDAVAEEVKKILA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MSAPKKIVVLPG ---CCCCCEEEECCC | 55.65 | 17644757 | |
6 | Ubiquitination | --MSAPKKIVVLPGD --CCCCCEEEECCCC | 39.41 | 17644757 | |
25 | Ubiquitination | EITAEAIKVLKAISD HHHHHHHHHHHHHHH | 48.87 | 17644757 | |
54 | Phosphorylation | GGAAIDATGVPLPDE CCEEEECCCCCCCHH | 34.66 | 28889911 | |
66 | Phosphorylation | PDEALEASKKADAVL CHHHHHHHHHCCEEE | 25.88 | 28889911 | |
67 | Ubiquitination | DEALEASKKADAVLL HHHHHHHHHCCEEEE | 60.06 | 17644757 | |
68 | Ubiquitination | EALEASKKADAVLLG HHHHHHHHCCEEEEC | 49.34 | 17644757 | |
81 | Ubiquitination | LGAVGGPKWGTGSVR ECCCCCCCCCCCCCC | 62.62 | 17644757 | |
84 | Phosphorylation | VGGPKWGTGSVRPEQ CCCCCCCCCCCCHHH | 25.76 | 21082442 | |
98 | Ubiquitination | QGLLKIRKELQLYAN HCHHHHHHHHHHHHC | 67.27 | 17644757 | |
123 | Ubiquitination | LLDLSPIKPQFAKGT CCCCCCCCCCCCCCC | 35.83 | 17644757 | |
128 | Ubiquitination | PIKPQFAKGTDFVVV CCCCCCCCCCCEEEE | 64.73 | 17644757 | |
226 | Phosphorylation | VQHQLIDSAAMILVK HHHHHHHCCEEECCC | 15.78 | 28889911 | |
277 | Ubiquitination | SLASLPDKNTAFGLY HHHHCCCCCCCCCCC | 55.01 | 17644757 | |
290 | Phosphorylation | LYEPCHGSAPDLPKN CCCCCCCCCCCCCCC | 16.98 | 28889911 | |
296 | Ubiquitination | GSAPDLPKNKVNPIA CCCCCCCCCCCCHHH | 76.36 | 17644757 | |
347 | Phosphorylation | GDLGGSNSTTEVGDA CCCCCCCCCCHHHHH | 38.10 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEU3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEU3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEU3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSY1_YEAST | SSY1 | genetic | 11788966 | |
GAP1_YEAST | GAP1 | genetic | 21526172 | |
LEUC_YEAST | LEU1 | genetic | 21926174 | |
IF2A_YEAST | SUI2 | genetic | 21919885 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-290, AND MASSSPECTROMETRY. |