LEP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LEP_MOUSE
• UniProt AC: P41160
• Protein Name: Leptin
• Gene Name: Lep
• Organism: Mus musculus (Mouse).
• Sequence Length: 167
• Subcellular Localization: Secreted .
• Protein Description: Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways. [PubMed: 15899045]
• Protein Sequence: MCWRPLCRFLWLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of LEP_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LEP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LEP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LEP_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLUS_HUMAN	CLU	physical	12824284
CLUS_MOUSE	Clu	physical	12824284
APOA1_HUMAN	APOA1	physical	12824284
LEPR_HUMAN	LEPR	physical	12824284

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.