UniProt ID | LEP_HUMAN | |
---|---|---|
UniProt AC | P41159 | |
Protein Name | Leptin {ECO:0000312|HGNC:HGNC:6553} | |
Gene Name | LEP {ECO:0000312|HGNC:HGNC:6553} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 167 | |
Subcellular Localization | Secreted . | |
Protein Description | Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways. [PubMed: 17344214] | |
Protein Sequence | MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | RINDISHTQSVSSKQ HHHHCCCCCCCCCCC | 18.75 | - | |
54 | Sulfoxidation | HTQSVSSKQKVTGLD CCCCCCCCCCCCCCC | 46.78 | 9587962 | |
68 | Sulfoxidation | DFIPGLHPILTLSKM CCCCCCCHHHHHHHH | 28.47 | 9587962 | |
114 | Phosphorylation | LLHVLAFSKSCHLPW HHHHHHHCCCCCCCC | 20.32 | 28102081 | |
136 | Sulfoxidation | DSLGGVLEASGYSTE HHHCCHHHHCCCCHH | 38.08 | 9587962 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEP_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...