| UniProt ID | LEG4_HUMAN | |
|---|---|---|
| UniProt AC | P56470 | |
| Protein Name | Galectin-4 | |
| Gene Name | LGALS4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 323 | |
| Subcellular Localization | ||
| Protein Description | Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.. | |
| Protein Sequence | MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 78 | Phosphorylation | WDKVVFNTLQGGKWG CCEEEEEECCCCCCC | 14.70 | 23312004 | |
| 83 | Acetylation | FNTLQGGKWGSEERK EEECCCCCCCCHHHH | 56.03 | 27178108 | |
| 86 | Phosphorylation | LQGGKWGSEERKRSM CCCCCCCCHHHHHCC | 34.86 | 27696853 | |
| 207 | Phosphorylation | GGLTARRTIIIKGYV CCEEECEEEEEEEEC | 15.81 | - | |
| 220 | Phosphorylation | YVPPTGKSFAINFKV ECCCCCCEEEEEEEE | 22.66 | 26657352 | |
| 229 | Phosphorylation | AINFKVGSSGDIALH EEEEEECCCCCEEEE | 33.85 | 26657352 | |
| 230 | Phosphorylation | INFKVGSSGDIALHI EEEEECCCCCEEEEE | 34.26 | 23312004 | |
| 258 | Phosphorylation | LLNGSWGSEEKKITH CCCCCCCCCCCCCCC | 36.00 | - | |
| 261 | Acetylation | GSWGSEEKKITHNPF CCCCCCCCCCCCCCC | 45.48 | 7666187 | |
| 277 | Phosphorylation | PGQFFDLSIRCGLDR CCCEEEEEEEECCCE | 15.16 | 24719451 | |
| 288 | Phosphorylation | GLDRFKVYANGQHLF CCCEEEEEECCEEHH | 8.57 | 23312004 | |
| 302 | Phosphorylation | FDFAHRLSAFQRVDT HHHHHHHHHHCCCCE | 27.30 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEG4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEG4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEG4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARPC3_HUMAN | ARPC3 | physical | 16169070 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
