dbPTM

LCN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LCN1_HUMAN
UniProt AC	P31025
Protein Name	Lipocalin-1
Gene Name	LCN1
Organism	Homo sapiens (Human).
Sequence Length	176
Subcellular Localization	Secreted.
Protein Description	Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket..
Protein Sequence	MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	QAHHLLASDEEIQDV HHHHHHCCCHHHCCC	45.59	22817900
32	Phosphorylation	DEEIQDVSGTWYLKA CHHHCCCCCCEEEEE	38.50	22817900
34	Phosphorylation	EIQDVSGTWYLKAMT HHCCCCCCEEEEEEE	11.93	22817900
36	Phosphorylation	QDVSGTWYLKAMTVD CCCCCCEEEEEEEEC	9.73	22817900
95	Phosphorylation	KTDEPGKYTADGGKH CCCCCCCEECCCCCE	17.05	-
105	Phosphorylation	DGGKHVAYIIRSHVK CCCCEEEEEEHHHCC	8.87	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LCN1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LCN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LCN1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PDYN_HUMAN	PDYN	physical	26186194
PDYN_HUMAN	PDYN	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LCN1_HUMAN

Related Literatures of Post-Translational Modification