UniProt ID | LANC2_HUMAN | |
---|---|---|
UniProt AC | Q9NS86 | |
Protein Name | LanC-like protein 2 | |
Gene Name | LANCL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 450 | |
Subcellular Localization | Nucleus . Cytoplasm . Cell membrane . Localizes to the juxta-nuclear vesicles (PubMed:16979580). Associates with the cortical actin cytoskeleton (PubMed:16979580). Cholesterol depletion by methyl-beta-cyclodextrin causes partial dissociation from the | |
Protein Description | Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.. | |
Protein Sequence | MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGETMSKRL ------CCCCHHHHH | 38.80 | - | |
2 | Myristoylation | ------MGETMSKRL ------CCCCHHHHH | 38.80 | 16979580 | |
4 | Phosphorylation | ----MGETMSKRLKL ----CCCCHHHHHHH | 22.48 | 27794612 | |
6 | Phosphorylation | --MGETMSKRLKLHL --CCCCHHHHHHHHC | 23.26 | 27794612 | |
19 | Sulfoxidation | HLGGEAEMEERAFVN HCCCCCHHHHHCCCC | 9.27 | 21406390 | |
82 | Ubiquitination | RRIQTKIKDLLQQME HHHHHHHHHHHHHHH | 43.83 | - | |
134 | 2-Hydroxyisobutyrylation | LRSLDYVKRTLRNLN HHHHHHHHHHHHHCC | 33.17 | - | |
164 | Ubiquitination | VGAVIYHKLRSDCES HHHHHHHHHHCCCCC | 28.73 | - | |
167 | Phosphorylation | VIYHKLRSDCESQEC HHHHHHHCCCCCHHH | 57.98 | 21406692 | |
171 | Phosphorylation | KLRSDCESQECVTKL HHHCCCCCHHHHHHH | 37.30 | 21406692 | |
176 | Phosphorylation | CESQECVTKLLQLQR CCCHHHHHHHHHHHH | 27.86 | 21406692 | |
198 | Phosphorylation | DLPDELLYGRAGYLY CCCHHHHHHHHHHHH | 19.72 | 19060867 | |
236 | Ubiquitination | NAIIESGKTLSREER HHHHHHCCCCCHHHH | 56.42 | - | |
239 | Phosphorylation | IESGKTLSREERKTE HHHCCCCCHHHHHHC | 42.76 | - | |
259 | Phosphorylation | YQWHRKQYVGAAHGM HHHHHHHHHHHHHHH | 12.13 | 21082442 | |
288 | Sulfoxidation | DQETLTEMVKPSIDY CHHHHHHHHCCCCCH | 3.85 | 28465586 | |
290 | Ubiquitination | ETLTEMVKPSIDYVR HHHHHHHCCCCCHHH | 31.56 | - | |
295 | Phosphorylation | MVKPSIDYVRHKKFR HHCCCCCHHHCCCCC | 9.56 | 24927040 | |
300 | Acetylation | IDYVRHKKFRSGNYP CCHHHCCCCCCCCCC | 39.63 | 7663155 | |
303 | Phosphorylation | VRHKKFRSGNYPSSL HHCCCCCCCCCCCCC | 34.23 | 28152594 | |
306 | Phosphorylation | KKFRSGNYPSSLSNE CCCCCCCCCCCCCCH | 14.17 | 28152594 | |
308 | Phosphorylation | FRSGNYPSSLSNETD CCCCCCCCCCCCHHH | 33.29 | 28152594 | |
309 | Phosphorylation | RSGNYPSSLSNETDR CCCCCCCCCCCHHHH | 31.17 | 24076635 | |
311 | Phosphorylation | GNYPSSLSNETDRLV CCCCCCCCCHHHHHH | 34.27 | 24076635 | |
314 | Phosphorylation | PSSLSNETDRLVHWC CCCCCCHHHHHHHHH | 30.57 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LANC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LANC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LANC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
MON1B_HUMAN | MON1B | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"Myristoylation of human LanC-like protein 2 (LANCL2) is essential forthe interaction with the plasma membrane and the increase in cellularsensitivity to adriamycin."; Landlinger C., Salzer U., Prohaska R.; Biochim. Biophys. Acta 1758:1759-1767(2006). Cited for: SUBCELLULAR LOCATION, MYRISTOYLATION AT GLY-2, MUTAGENESIS OF GLY-2,AND INTERACTION WITH INOSITOL PHOSPHOLIPIDS. |