dbPTM

KSG9_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KSG9_ARATH
UniProt AC	Q39012
Protein Name	Shaggy-related protein kinase iota
Gene Name	ASK9
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	407
Subcellular Localization
Protein Description	Phosphorylates BSK1, BSK3, BSK5, BSK6, BSK8 AND BSK11 in vitro. [PubMed: 23496207 May mediate extracellular signals to regulate transcription in differentiating cells (By similarity]
Protein Sequence	MASLPLGPQPHALAPPLQLHDGDALKRRPELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLRHYTSSNQRMPIFYVKLYTYQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTASIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGLQNS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASLPLGPQ ------CCCCCCCCC	21.56	-
229	Phosphorylation	VKGEPNISYICSRYY ECCCCCHHHHHCCCC	18.32	23776212
230	Phosphorylation	KGEPNISYICSRYYR CCCCCHHHHHCCCCC	11.36	30291188
233	Phosphorylation	PNISYICSRYYRAPE CCHHHHHCCCCCCCH	17.48	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KSG9_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KSG9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KSG9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LBD13_ARATH	LBD13	physical	21798944
Y4523_ARATH	BSK1	physical	23496207
Y5126_ARATH	AT5G41260	physical	23496207
ABI5_ARATH	ABI5	physical	25415975
KSG9_ARATH	GSK1	physical	25969537

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KSG9_ARATH

Related Literatures of Post-Translational Modification