dbPTM

KSG8_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KSG8_ARATH
UniProt AC	Q96287
Protein Name	Shaggy-related protein kinase theta
Gene Name	ASK8
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	472
Subcellular Localization
Protein Description	May mediate extracellular signals to regulate transcription in differentiating cells..
Protein Sequence	MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQVDQNSSCFEMKADVLSQESVAGTSNVPAVSEKPVDDQLPDVMIEMKIRDERNANREDKDMETTVVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIFVQLYTYQICRALNYLHRVVGVCHRDIKPQNLLVNPQTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTNAIDMWSGGCVMAELLLGQPLFPGESGIDQLVEIIKILGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGRALPPLFNFTAQELAGASTELRQRLIPAHCQGTGSSS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	NVMRRLKSIASGRTS CHHHHHHHHHCCCCC	28.16	23111157
12	Phosphorylation	RRLKSIASGRTSISS HHHHHHHCCCCCCCC	27.43	23111157
15	Phosphorylation	KSIASGRTSISSDPG HHHHCCCCCCCCCCC	33.66	30407730
16	Phosphorylation	SIASGRTSISSDPGG HHHCCCCCCCCCCCH	21.07	30407730
18	Phosphorylation	ASGRTSISSDPGGDY HCCCCCCCCCCCHHH	28.58	30407730
19	Phosphorylation	SGRTSISSDPGGDYA CCCCCCCCCCCHHHH	46.27	30407730
297	Phosphorylation	VPGEPNISYICSRYY CCCCCCHHHHHCHHH	18.32	23776212
298	Phosphorylation	PGEPNISYICSRYYR CCCCCHHHHHCHHHC	11.36	30291188
301	Phosphorylation	PNISYICSRYYRAPE CCHHHHHCHHHCCCH	17.48	23776212
472	Phosphorylation	CQGTGSSS------- HCCCCCCC-------	46.03	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KSG8_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KSG8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KSG8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KSG8_ARATH	SK32	physical	25969537

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KSG8_ARATH

Related Literatures of Post-Translational Modification