UniProt ID | KSG4_ARATH | |
---|---|---|
UniProt AC | Q9FVS6 | |
Protein Name | Shaggy-related protein kinase delta | |
Gene Name | ASK4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 420 | |
Subcellular Localization | ||
Protein Description | May mediate extracellular signals to regulate transcription in differentiating cells.. | |
Protein Sequence | MESHLGNGVGSSRSAKNTKNTSSSVDWLSRDMLEMKIRDKTEADEERDSEPDIIDGVGAEPGHVITTTLPGRNGQSRQTVSYIAEHVVGTGSFGMVFQAKCRETGEVVAIKKVLQDKRYKNRELQIMQMLDHPNVVCLKHSFYSRTENEEVYLNLVLEFVPETVNRTARSYSRMNQLMPLIYVKLYTYQICRGLAYLHNCCGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTAVEACIHPFFDELRDPNARLPNGRPLPPLFNFKPQELSGIPPETVDRLVPEHARKQNHFMALHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | NTKNTSSSVDWLSRD CCCCCCCCHHHHHHH | 24.70 | 30291188 | |
241 | Phosphorylation | VKGEPNISYICSRYY ECCCCCHHHHHCCCC | 18.32 | 23776212 | |
242 | Phosphorylation | KGEPNISYICSRYYR CCCCCHHHHHCCCCC | 11.36 | 30291188 | |
245 | Phosphorylation | PNISYICSRYYRAPE CCHHHHHCCCCCCCH | 17.48 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KSG4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KSG4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KSG4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KSG4_ARATH | SK42 | physical | 25969537 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...