KSG4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KSG4_ARATH
• UniProt AC: Q9FVS6
• Protein Name: Shaggy-related protein kinase delta
• Gene Name: ASK4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 420
• Protein Description: May mediate extracellular signals to regulate transcription in differentiating cells..
• Protein Sequence: MESHLGNGVGSSRSAKNTKNTSSSVDWLSRDMLEMKIRDKTEADEERDSEPDIIDGVGAEPGHVITTTLPGRNGQSRQTVSYIAEHVVGTGSFGMVFQAKCRETGEVVAIKKVLQDKRYKNRELQIMQMLDHPNVVCLKHSFYSRTENEEVYLNLVLEFVPETVNRTARSYSRMNQLMPLIYVKLYTYQICRGLAYLHNCCGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTAVEACIHPFFDELRDPNARLPNGRPLPPLFNFKPQELSGIPPETVDRLVPEHARKQNHFMALHS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	NTKNTSSSVDWLSRD CCCCCCCCHHHHHHH	24.70	30291188
241	Phosphorylation	VKGEPNISYICSRYY ECCCCCHHHHHCCCC	18.32	23776212
242	Phosphorylation	KGEPNISYICSRYYR CCCCCHHHHHCCCCC	11.36	30291188
245	Phosphorylation	PNISYICSRYYRAPE CCHHHHHCCCCCCCH	17.48	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KSG4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KSG4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KSG4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KSG4_ARATH	SK42	physical	25969537

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.