dbPTM

KREM2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KREM2_MOUSE
UniProt AC	Q8K1S7
Protein Name	Kremen protein 2
Gene Name	Kremen2
Organism	Mus musculus (Mouse).
Sequence Length	461
Subcellular Localization	Membrane Single-pass type I membrane protein .
Protein Description	Receptor for Dickkopf proteins. Cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. [PubMed: 12050670 Plays a role in limb development; attenuates Wnt signaling in the developing limb to allow normal limb patterning and can also negatively regulate bone formation]
Protein Sequence	MGTPHLQGFLLLFPLLLRLHGASAGSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWSAPQGVIYSPDFPDEYGPDRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNLLRAFDGAHPPPPGPLRLRTAALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTESLAGDPDGANASCSPKPGAAQASIGARVFSTVTAFSVLLLLLLSLLRLLRRRSCLLAPGKGSLAMGPSRGPGRSWAVWYRRPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLRSLVSAL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	N-linked_Glycosylation	ADYRGHQNYTGPRGA CCCCCCCCCCCCCCC	30.57	-
221	N-linked_Glycosylation	SVGSCQGNWSAPQGV EECCCCCCCCCCCCE	12.03	-
243	N-linked_Glycosylation	DEYGPDRNCSWVLGQ HHHCCCCCCHHHHHH	31.39	-
350	N-linked_Glycosylation	AGDPDGANASCSPKP CCCCCCCCCCCCCCC	37.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KREM2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KREM2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KREM2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
LRP6_MOUSE	Lrp6	physical	16126904

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KREM2_MOUSE

Related Literatures of Post-Translational Modification