KPRS4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KPRS4_ARATH
• UniProt AC: Q680A5
• Protein Name: Ribose-phosphate pyrophosphokinase 4
• Gene Name: PRS4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 337
• Protein Sequence: MSENAANNIMETKICTDAIVSELQKKKVHLFYCLECEELARNIAAESDHITLQSINWRSFADGFPNLFINNAHDIRGQHVAFLASFSSPAVIFEQISVIYLLPRLFVASFTLVLPFFPTGSFERMEEEGDVATAFTMARIVSNIPISRGGPTSVVIYDIHALQERFYFADQVLPLFETGIPLLTKRLQQLPETEKVIVAFPDDGAWKRFHKLLDHYPTVVCTKVREGDKRIVRLKEGNPAGCHVVIVDDLVQSGGTLIECQKVLAAHGAVKVSAYVTHGVFPKSSWERFTHKKNGLEEAFAYFWITDSCPQTVKAIGNKAPFEVLSLAGSIADALQI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSENAANNI ------CCHHHHHHH	39.29	22223895
2	Phosphorylation	------MSENAANNI ------CCHHHHHHH	39.29	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KPRS4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KPRS4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KPRS4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KPRS4_ARATH	AT2G42910	physical	21798944
PKP4_ARATH	AT3G49160	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.