| UniProt ID | KLF2_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5W3 | |
| Protein Name | Krueppel-like factor 2 | |
| Gene Name | KLF2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 355 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription.. | |
| Protein Sequence | MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | LSEPILPSFSTFASP CCCCCCCCCCCCCHH | 28.52 | 22199227 | |
| 12 | Phosphorylation | EPILPSFSTFASPCR CCCCCCCCCCCHHHH | 27.27 | 22199227 | |
| 13 | Phosphorylation | PILPSFSTFASPCRE CCCCCCCCCCHHHHH | 22.62 | 24719451 | |
| 16 | Phosphorylation | PSFSTFASPCRERGL CCCCCCCHHHHHCCH | 21.97 | 22199227 | |
| 122 | Sumoylation | APPGRLVKAEPPEAD CCCCCEEECCCCCCC | 52.18 | - | |
| 122 | Sumoylation | APPGRLVKAEPPEAD CCCCCEEECCCCCCC | 52.18 | - | |
| 148 | Sumoylation | TRGPRGLKREGAPGP CCCCCCCCCCCCCCC | 51.75 | - | |
| 148 | Sumoylation | TRGPRGLKREGAPGP CCCCCCCCCCCCCCC | 51.75 | - | |
| 173 | Phosphorylation | RPPPPPDTPPLSPDG CCCCCCCCCCCCCCC | 32.36 | 23401153 | |
| 177 | Phosphorylation | PPDTPPLSPDGPARL CCCCCCCCCCCCCCC | 27.07 | 23401153 | |
| 244 | Phosphorylation | PAARGLLTPPASPLE HHHHCCCCCCCCHHH | 32.06 | 22617229 | |
| 248 | Phosphorylation | GLLTPPASPLELLEA CCCCCCCCHHHHHHC | 35.47 | 22617229 | |
| 263 | Phosphorylation | KPKRGRRSWPRKRTA CCCCCCCCCCCCCCC | 39.82 | 24719451 | |
| 282 | Phosphorylation | SYAGCGKTYTKSSHL CCCCCCCCEECCHHH | 23.00 | 26074081 | |
| 283 | Phosphorylation | YAGCGKTYTKSSHLK CCCCCCCEECCHHHH | 18.69 | 26074081 | |
| 284 | Phosphorylation | AGCGKTYTKSSHLKA CCCCCCEECCHHHHH | 29.67 | 26074081 | |
| 286 | Phosphorylation | CGKTYTKSSHLKAHL CCCCEECCHHHHHHH | 18.39 | 20166139 | |
| 287 | Phosphorylation | GKTYTKSSHLKAHLR CCCEECCHHHHHHHH | 34.10 | 20166139 | |
| 290 | Ubiquitination | YTKSSHLKAHLRTHT EECCHHHHHHHHHCC | 28.47 | - | |
| 290 | Sumoylation | YTKSSHLKAHLRTHT EECCHHHHHHHHHCC | 28.47 | - | |
| 290 | Sumoylation | YTKSSHLKAHLRTHT EECCHHHHHHHHHCC | 28.47 | - | |
| 295 | Phosphorylation | HLKAHLRTHTGEKPY HHHHHHHHCCCCCCC | 30.10 | 26074081 | |
| 297 | Phosphorylation | KAHLRTHTGEKPYHC HHHHHHCCCCCCCCC | 46.56 | 26074081 | |
| 327 | Phosphorylation | TRHYRKHTGHRPFQC HHHHHHHHCCCCEEC | 37.40 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| - | K | Ubiquitination | E3 ubiquitin ligase | FBXW7 | Q969H0 | PMID:23507969 |
| - | K | Ubiquitination | E3 ubiquitin ligase | WWP1 | Q9H0M0 | PMID:15003522 |
| - | K | Ubiquitination | E3 ubiquitin ligase | SMURF1 | Q9HCE7 | PMID:21382345 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLF2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLF2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WWP1_HUMAN | WWP1 | physical | 11375995 | |
| WWP1_HUMAN | WWP1 | physical | 15003522 | |
| SMUF1_HUMAN | SMURF1 | physical | 21382345 | |
| KAT2B_HUMAN | KAT2B | physical | 16617118 | |
| PSME3_HUMAN | PSME3 | physical | 26776519 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...